BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS1065 (548 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC23B6.03c |tel1||ATM checkpoint kinase|Schizosaccharomyces po... 25 9.7 SPAC13G6.01c |rad8|SPAC5H10.14c|ubiquitin-protein ligase E3 |Sch... 25 9.7 SPAC222.11 |hem13||coproporphyrinogen III oxidase |Schizosacchar... 25 9.7 >SPCC23B6.03c |tel1||ATM checkpoint kinase|Schizosaccharomyces pombe|chr 3|||Manual Length = 2812 Score = 24.6 bits (51), Expect = 9.7 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = +2 Query: 227 RWLPKXFIATHKLVLSVCSPYFQEMFQMNPTQH 325 +++ K FI T LS + + +FQ++PT H Sbjct: 982 KFIEKVFIETKFSSLSGRQTFLKFIFQLSPTSH 1014 >SPAC13G6.01c |rad8|SPAC5H10.14c|ubiquitin-protein ligase E3 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1133 Score = 24.6 bits (51), Expect = 9.7 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -2 Query: 259 MCCNKPLRQPTLRLRDLHATAG 194 +CCN+P++ P L L HA G Sbjct: 879 ICCNEPIQNPLL-LNCKHACCG 899 >SPAC222.11 |hem13||coproporphyrinogen III oxidase |Schizosaccharomyces pombe|chr 1|||Manual Length = 312 Score = 24.6 bits (51), Expect = 9.7 Identities = 12/47 (25%), Positives = 24/47 (51%), Gaps = 1/47 (2%) Frame = +2 Query: 227 RWLPKXFIATH-KLVLSVCSPYFQEMFQMNPTQHPIVFLKDVSHSAL 364 +W + F+ H K + +F ++ + +P Q F+KD +H+ L Sbjct: 177 KWADEYFLIKHRKETRGIGGIFFDDLSEKDP-QELFAFVKDCAHTFL 222 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,290,795 Number of Sequences: 5004 Number of extensions: 44517 Number of successful extensions: 91 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 89 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 91 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 227943826 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -