BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS1065 (548 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. 68 5e-14 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 59 3e-11 AB095513-1|BAC76335.1| 39|Apis mellifera brood-complex protein. 38 5e-05 DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like recept... 23 2.7 AB194707-1|BAD69622.1| 247|Apis mellifera heme oxygenase protein. 23 2.7 DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protei... 22 4.7 AY588474-1|AAT94401.1| 104|Apis mellifera defensin 2 protein. 21 6.2 AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 21 8.2 >AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. Length = 429 Score = 68.1 bits (159), Expect = 5e-14 Identities = 30/75 (40%), Positives = 48/75 (64%) Frame = +2 Query: 248 IATHKLVLSVCSPYFQEMFQMNPTQHPIVFLKDVSHSALRDLLQFMYQGEVNVKPED*HH 427 + H++VLS CSPYF+E+ + P +HP++ L+DV+ S L L++F+Y GEVNV Sbjct: 43 LKAHRVVLSACSPYFRELLKSTPCKHPVIVLQDVAFSDLHALVEFIYHGEVNVHQRSLSS 102 Query: 428 LLVQRTTSSXRLTGI 472 L +T R++G+ Sbjct: 103 FL--KTAEVLRVSGL 115 Score = 37.1 bits (82), Expect = 1e-04 Identities = 15/39 (38%), Positives = 23/39 (58%) Frame = +1 Query: 124 MASDEQFSLCWNNFHANMSAGFHGLLSRGDLVDVTLAAE 240 M + F L WNN+ +++++ F L D VDVTLA + Sbjct: 1 MVDTQHFCLRWNNYQSSITSAFENLRDDEDFVDVTLACD 39 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 58.8 bits (136), Expect = 3e-11 Identities = 27/76 (35%), Positives = 48/76 (63%), Gaps = 1/76 (1%) Frame = +2 Query: 248 IATHKLVLSVCSPYFQEMFQMNPTQHP-IVFLKDVSHSALRDLLQFMYQGEVNVKPED*H 424 + HK+VLS CS YFQ++ NP +HP I+ +DV + L+ +++F+Y+GE++V + Sbjct: 47 LKAHKVVLSACSSYFQKLLLSNPCKHPTIIMPQDVCFNDLKFIIEFVYRGEIDVSQAELQ 106 Query: 425 HLLVQRTTSSXRLTGI 472 LL +T ++ G+ Sbjct: 107 SLL--KTADQLKIKGL 120 Score = 37.9 bits (84), Expect = 7e-05 Identities = 16/33 (48%), Positives = 22/33 (66%) Frame = +1 Query: 136 EQFSLCWNNFHANMSAGFHGLLSRGDLVDVTLA 234 + + L WNN+ +NM++ FH LL VDVTLA Sbjct: 9 QHYCLRWNNYQSNMTSVFHQLLQTEAFVDVTLA 41 >AB095513-1|BAC76335.1| 39|Apis mellifera brood-complex protein. Length = 39 Score = 38.3 bits (85), Expect = 5e-05 Identities = 16/39 (41%), Positives = 23/39 (58%) Frame = +1 Query: 124 MASDEQFSLCWNNFHANMSAGFHGLLSRGDLVDVTLAAE 240 M + F L WNN+ +++++ F L D VDVTLA E Sbjct: 1 MVDTQHFCLRWNNYQSSITSAFENLRDDEDFVDVTLACE 39 >DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like receptor 2 protein. Length = 581 Score = 22.6 bits (46), Expect = 2.7 Identities = 13/44 (29%), Positives = 21/44 (47%) Frame = +1 Query: 100 VPRRVVAIMASDEQFSLCWNNFHANMSAGFHGLLSRGDLVDVTL 231 V R +VA++ + F +CW FHA + S+ DV + Sbjct: 283 VIRMLVAVVVA---FFICWAPFHAQRLLAVYAQNSKDKPEDVLI 323 >AB194707-1|BAD69622.1| 247|Apis mellifera heme oxygenase protein. Length = 247 Score = 22.6 bits (46), Expect = 2.7 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = -1 Query: 494 WRRGLLIGYRLTXYLKLSAV 435 W GLL+ Y + YL+L+ + Sbjct: 42 WADGLLVFYEVFRYLELAMI 61 >DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protein protein. Length = 424 Score = 21.8 bits (44), Expect = 4.7 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +2 Query: 101 FHVESSLSWRRTNNFHY 151 + +S SWR TNN Y Sbjct: 211 YDFRNSRSWRITNNLFY 227 >AY588474-1|AAT94401.1| 104|Apis mellifera defensin 2 protein. Length = 104 Score = 21.4 bits (43), Expect = 6.2 Identities = 6/18 (33%), Positives = 10/18 (55%) Frame = -3 Query: 489 AWTSHWIPVNLXLEVVRC 436 +W S W+ +N +RC Sbjct: 68 SWQSKWLSINHSACAIRC 85 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 21.0 bits (42), Expect = 8.2 Identities = 7/24 (29%), Positives = 12/24 (50%) Frame = -1 Query: 143 NCSSDAMIATTRRGTYPKLCTYNS 72 NC D + +RGT + C + + Sbjct: 479 NCDIDCINRVVQRGTKMQFCIFRT 502 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 155,943 Number of Sequences: 438 Number of extensions: 2900 Number of successful extensions: 16 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15704448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -