BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS1061 (359 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase pro... 21 3.3 AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. 21 5.9 EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 20 7.7 >AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase protein. Length = 580 Score = 21.4 bits (43), Expect = 3.3 Identities = 7/16 (43%), Positives = 10/16 (62%) Frame = -3 Query: 144 GLSNNTWLFNLSRTFP 97 GLS+ W++ S T P Sbjct: 542 GLSHGNWIYPASMTIP 557 >AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. Length = 493 Score = 20.6 bits (41), Expect = 5.9 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +3 Query: 51 RKDPVAAKPRRRSGPKEKFVTS*TTRC 131 R P++ K RSG +E+F+ RC Sbjct: 79 RYQPISYKWITRSGTREQFIDM-VARC 104 Score = 20.2 bits (40), Expect = 7.7 Identities = 5/9 (55%), Positives = 7/9 (77%) Frame = -1 Query: 86 SSSWLCRHR 60 S+ W+C HR Sbjct: 375 SNGWICEHR 383 >EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase protein. Length = 620 Score = 20.2 bits (40), Expect = 7.7 Identities = 9/36 (25%), Positives = 19/36 (52%) Frame = +3 Query: 240 KSTHRLREKGLIKQVVQHHGQVIYTRATKGDDPVAK 347 K+T++ EKG + + + + V+Y + + AK Sbjct: 146 KNTNKFLEKGPVALINELYPGVVYKCVSDNGESYAK 181 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 107,329 Number of Sequences: 438 Number of extensions: 2398 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 51 effective length of database: 124,005 effective search space used: 8432340 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -