BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS1059 (449 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g17705.1 68415.m02051 expressed protein 29 1.9 At1g78510.1 68414.m09151 solanesyl diphosphate synthase (SPS) id... 27 7.7 >At2g17705.1 68415.m02051 expressed protein Length = 135 Score = 28.7 bits (61), Expect = 1.9 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +1 Query: 124 TTIMCTPCGPMVCYKYEDCGPPL 192 T I CT C ++ Y Y+D GPPL Sbjct: 72 TKIKCTSCNHLIGYIYDD-GPPL 93 >At1g78510.1 68414.m09151 solanesyl diphosphate synthase (SPS) identical to solanesyl diphosphate synthase [Arabidopsis thaliana] GI:19911233; contains Pfam profile PF00348: Polyprenyl synthetase Length = 406 Score = 26.6 bits (56), Expect = 7.7 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = +1 Query: 166 KYEDCGPPLQCLPRSAFKRNGLQDCQFFQQVR 261 K +D LQCLPRS F R+ L+D + R Sbjct: 374 KADDAIKNLQCLPRSGF-RSALEDMVLYNLER 404 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,350,188 Number of Sequences: 28952 Number of extensions: 178002 Number of successful extensions: 372 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 365 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 372 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 732537840 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -