BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS1007 (648 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY330172-1|AAQ16278.1| 170|Anopheles gambiae odorant-binding pr... 25 2.7 AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcript... 23 6.3 AY301275-1|AAQ67361.1| 611|Anopheles gambiae G-protein coupled ... 23 8.3 AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/p... 23 8.3 AJ439353-2|CAD27924.1| 612|Anopheles gambiae putative G-protein... 23 8.3 >AY330172-1|AAQ16278.1| 170|Anopheles gambiae odorant-binding protein AgamOBP52 protein. Length = 170 Score = 24.6 bits (51), Expect = 2.7 Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Frame = -2 Query: 518 PSLVKHGSTYCWETAAFNHENLT-LFHRCFR 429 P + +H ST C E A NH T LF C++ Sbjct: 40 PLIPEHVSTKCKEREAANHNPGTELFEVCYQ 70 >AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcriptase protein. Length = 1022 Score = 23.4 bits (48), Expect = 6.3 Identities = 12/30 (40%), Positives = 19/30 (63%), Gaps = 5/30 (16%) Frame = -3 Query: 247 LIPSLQPWI-----SFYLHVSETFVTGSAF 173 LIP++QPWI + H+S+ F++G F Sbjct: 875 LIPNIQPWITRRHGNIEFHMSQ-FLSGHGF 903 >AY301275-1|AAQ67361.1| 611|Anopheles gambiae G-protein coupled receptor protein. Length = 611 Score = 23.0 bits (47), Expect = 8.3 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -2 Query: 509 VKHGSTYCWETAAFNHEN 456 V+ GS Y ++ FNH N Sbjct: 490 VREGSVYFQRSSTFNHHN 507 >AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/proton exchanger 3 protein. Length = 1221 Score = 23.0 bits (47), Expect = 8.3 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = +3 Query: 243 IRGKVSXSKLHKESTAKKDLRPSSAISF 326 IR +S K HK S KD + + +SF Sbjct: 838 IRRMISEKKHHKRSKRVKDGKQQNHVSF 865 >AJ439353-2|CAD27924.1| 612|Anopheles gambiae putative G-protein coupled receptor protein. Length = 612 Score = 23.0 bits (47), Expect = 8.3 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -2 Query: 509 VKHGSTYCWETAAFNHEN 456 V+ GS Y ++ FNH N Sbjct: 491 VREGSVYFQRSSTFNHHN 508 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 572,501 Number of Sequences: 2352 Number of extensions: 10713 Number of successful extensions: 18 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 63977715 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -