BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS1006 (698 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protei... 25 0.69 AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein... 24 1.2 DQ091184-1|AAZ42364.1| 157|Apis mellifera lipophorin receptor p... 23 3.7 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 22 4.9 DQ091183-1|AAZ42363.1| 128|Apis mellifera lipophorin receptor p... 21 8.5 >AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protein kinase foraging protein. Length = 678 Score = 25.0 bits (52), Expect = 0.69 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 224 CLGLSLWTWSRDNGLCTLGTIR 289 CLG LWT RD G GT R Sbjct: 448 CLGGELWTVLRDKGHFDDGTTR 469 >AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein protein. Length = 411 Score = 24.2 bits (50), Expect = 1.2 Identities = 7/20 (35%), Positives = 14/20 (70%) Frame = +3 Query: 381 VDSVLDVVRKEAEGCDCLQG 440 +DS+++++R + CD L G Sbjct: 106 IDSIINIIRVRVDACDRLWG 125 >DQ091184-1|AAZ42364.1| 157|Apis mellifera lipophorin receptor protein. Length = 157 Score = 22.6 bits (46), Expect = 3.7 Identities = 17/54 (31%), Positives = 25/54 (46%), Gaps = 7/54 (12%) Frame = -3 Query: 384 LPAPRLRCSDP*PSC-CQHP---IAQRQSCPDGRSDRMVPSVQ---SPLSRLQV 244 LPAPR+ P SC C ++ C + S +VP+ Q P RL++ Sbjct: 48 LPAPRINSKSPLLSCACPDGLKLLSDGLMCVEKVSTTIVPTTQEINKPFKRLEL 101 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 22.2 bits (45), Expect = 4.9 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = +2 Query: 530 IMNTFSIVPSPKVSDTVVEPYNATLSVHQLVEN 628 I + F ++ +PKVS+ ATLS +++ N Sbjct: 546 IRSFFELLQNPKVSNEQFLNTAATLSFCEMIHN 578 >DQ091183-1|AAZ42363.1| 128|Apis mellifera lipophorin receptor protein. Length = 128 Score = 21.4 bits (43), Expect = 8.5 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = -3 Query: 384 LPAPRLRCSDP*PSCCQHPIAQRQSCPDG 298 LPAPR+ P SC +CPDG Sbjct: 48 LPAPRINSKSPLLSC---------ACPDG 67 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 202,950 Number of Sequences: 438 Number of extensions: 4516 Number of successful extensions: 12 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21439440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -