BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0992 (698 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z74028-2|CAA98428.1| 1058|Caenorhabditis elegans Hypothetical pr... 28 7.4 Z75549-2|CAA99916.1| 313|Caenorhabditis elegans Hypothetical pr... 27 9.8 AF106575-17|AAD56300.2| 333|Caenorhabditis elegans Serpentine r... 27 9.8 >Z74028-2|CAA98428.1| 1058|Caenorhabditis elegans Hypothetical protein C14C10.4 protein. Length = 1058 Score = 27.9 bits (59), Expect = 7.4 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = +1 Query: 115 DVVEARGELYRNVAEREENEQGR 183 +VV R R +AERE+NEQGR Sbjct: 263 NVVRLRCAAARAIAEREKNEQGR 285 >Z75549-2|CAA99916.1| 313|Caenorhabditis elegans Hypothetical protein T19C4.2 protein. Length = 313 Score = 27.5 bits (58), Expect = 9.8 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = -2 Query: 412 INLIEFNNTSQIFYSS 365 INL+ F NTSQ+FYS+ Sbjct: 133 INLLPFINTSQLFYST 148 >AF106575-17|AAD56300.2| 333|Caenorhabditis elegans Serpentine receptor, class h protein5 protein. Length = 333 Score = 27.5 bits (58), Expect = 9.8 Identities = 12/38 (31%), Positives = 22/38 (57%) Frame = -2 Query: 373 YSSYKKIDNLF*ILLNNTTYSLKYLISLI*VIICFATS 260 +S Y DN F + ++ + + YLI I ++CF++S Sbjct: 175 FSGYMWCDNCFFMNFDSNIFKIFYLICGIGTVMCFSSS 212 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,126,235 Number of Sequences: 27780 Number of extensions: 273024 Number of successful extensions: 836 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 795 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 836 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1613473434 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -