BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0988 (698 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_57322| Best HMM Match : DNA_pol_A (HMM E-Value=1.7e-07) 30 1.6 SB_46626| Best HMM Match : wnt (HMM E-Value=0) 29 4.8 SB_57750| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_12028| Best HMM Match : DAG1 (HMM E-Value=0.22) 28 8.4 SB_3540| Best HMM Match : RF-1 (HMM E-Value=2.1) 28 8.4 SB_52816| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 SB_48138| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 SB_21715| Best HMM Match : Serglycin (HMM E-Value=0.054) 28 8.4 >SB_57322| Best HMM Match : DNA_pol_A (HMM E-Value=1.7e-07) Length = 246 Score = 30.3 bits (65), Expect = 1.6 Identities = 15/26 (57%), Positives = 19/26 (73%), Gaps = 1/26 (3%) Frame = +2 Query: 392 PPQQVDFED-EQEMRFVYSVIYDVFR 466 PP +VDF++ E+ R VYSVIY V R Sbjct: 5 PPVKVDFKERERTKRIVYSVIYGVGR 30 >SB_46626| Best HMM Match : wnt (HMM E-Value=0) Length = 359 Score = 28.7 bits (61), Expect = 4.8 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = -1 Query: 644 CPAPSNSCVARSCSALGLASQRRLANSIR 558 C PS SCV R+CS L S R ++N ++ Sbjct: 242 CHGPSASCVTRTCSQ-ALPSPRAVSNRLK 269 >SB_57750| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 281 Score = 28.3 bits (60), Expect = 6.3 Identities = 16/36 (44%), Positives = 18/36 (50%) Frame = -1 Query: 692 KCTLCSQTTFSISLNGCPAPSNSCVARSCSALGLAS 585 K +L S SL GCPAPS A C LG A+ Sbjct: 16 KVSLIKMLDNSSSLRGCPAPS-KLTADDCFELGTAA 50 >SB_12028| Best HMM Match : DAG1 (HMM E-Value=0.22) Length = 1249 Score = 27.9 bits (59), Expect = 8.4 Identities = 14/48 (29%), Positives = 26/48 (54%) Frame = -2 Query: 583 SDVSLTPSGIAKLCDGCRCTVGSQPELNIVHGLVQDTFISENVINNRI 440 +D S+TP+ + K+ TV P+L +V+ + + T S V N ++ Sbjct: 806 TDSSITPTTVTKVIPTSTATVVIPPDLVVVNDIGRVTVTSGKVFNYQV 853 >SB_3540| Best HMM Match : RF-1 (HMM E-Value=2.1) Length = 395 Score = 27.9 bits (59), Expect = 8.4 Identities = 15/55 (27%), Positives = 31/55 (56%), Gaps = 2/55 (3%) Frame = +3 Query: 15 LYVSKENQKNRFKIFSNYMKK*INKNTRFIKL--FLLSVRMHRSHASKNQINNMR 173 L + ++N + +F +F NY + + ++ FIK ++L R+ R + KN + + R Sbjct: 257 LKLKEQNARLQFVLFGNYRSRVVQEDVLFIKADNYILR-RLVRKNIVKNYVKSSR 310 >SB_52816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1622 Score = 27.9 bits (59), Expect = 8.4 Identities = 18/66 (27%), Positives = 29/66 (43%) Frame = +2 Query: 344 VWDIGQVLKAARLLCKPPQQVDFEDEQEMRFVYSVIYDVFRYKCVLDQAMDDIEFWLTTH 523 +W I K + + + E R +Y VI +F C + + I FW+ +H Sbjct: 759 LWKIQTFTKISHYVTGSFSGIVAEFTMTRRALYYVI-QIF-LPCAMIVFLSWISFWIDSH 816 Query: 524 STPATV 541 STPA + Sbjct: 817 STPARI 822 >SB_48138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1913 Score = 27.9 bits (59), Expect = 8.4 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = +2 Query: 410 FEDEQEMRFVYSVIYDVFRYKCVLDQAMDDIEFW 511 F+D+ E R YS+ + RY+ VL+ + D F+ Sbjct: 109 FDDDLERRRAYSMAFGAKRYELVLEDVLLDSYFF 142 >SB_21715| Best HMM Match : Serglycin (HMM E-Value=0.054) Length = 1079 Score = 27.9 bits (59), Expect = 8.4 Identities = 19/84 (22%), Positives = 40/84 (47%) Frame = +3 Query: 24 SKENQKNRFKIFSNYMKK*INKNTRFIKLFLLSVRMHRSHASKNQINNMRPMILEDRTAF 203 SK+N+ +R + ++ +K +K K+F + + + + + N + M + ++ Sbjct: 767 SKKNKNHRRRHSAHEHRKDNDKE----KIFEMDAKKEQENGNTNDEEELEDMSMAEKPGS 822 Query: 204 TSLTNDDSEQQQKPVEEHRRSGHR 275 S D+E + P + HRR HR Sbjct: 823 QS----DNELNRPPQDRHRRHHHR 842 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,175,389 Number of Sequences: 59808 Number of extensions: 476545 Number of successful extensions: 1346 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1237 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1346 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1829596184 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -