Bombyx BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0986
         (748 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ223614-1|CAA11490.1|  301|Tribolium castaneum orthodenticle-2 ...    25   0.49 
EF592536-1|ABQ95982.1|  598|Tribolium castaneum beta-N-acetylglu...    21   7.9  

>AJ223614-1|CAA11490.1|  301|Tribolium castaneum orthodenticle-2
           protein protein.
          Length = 301

 Score = 25.4 bits (53), Expect = 0.49
 Identities = 17/49 (34%), Positives = 23/49 (46%)
 Frame = -3

Query: 245 SXSAANVTSTRSPRDSRP*KPADIFAWKLFQHSENCSSDAMIATTRRGT 99
           S + A+ T T S   S    PA I ++ L QH   CSS   + +T   T
Sbjct: 202 SPTIASATYTNSANSSIW-SPASIDSFTLEQHRSWCSSSQPVLSTTNST 249


>EF592536-1|ABQ95982.1|  598|Tribolium castaneum
           beta-N-acetylglucosaminidase NAG1 protein.
          Length = 598

 Score = 21.4 bits (43), Expect = 7.9
 Identities = 7/13 (53%), Positives = 12/13 (92%)
 Frame = -3

Query: 659 EEELFDAIDGLFG 621
           +E+L+DAI+ L+G
Sbjct: 337 KEKLYDAIEALYG 349


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 167,497
Number of Sequences: 336
Number of extensions: 3364
Number of successful extensions: 3
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of database: 122,585
effective HSP length: 56
effective length of database: 103,769
effective search space used: 19923648
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)