BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0983 (698 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_01_0308 + 2434642-2434736,2435176-2435245,2435435-2435566,243... 38 0.008 10_08_1052 - 22567937-22568329,22568436-22568669,22568787-225691... 30 2.0 02_01_0151 + 1067067-1067222,1067586-1067690,1067904-1067990,106... 29 2.7 09_04_0292 - 16436918-16439233 29 4.7 08_02_1335 - 26226784-26227015,26227493-26228474,26229021-26230686 29 4.7 04_04_0097 - 22782031-22782122,22782504-22782570,22782769-227828... 28 8.2 >05_01_0308 + 2434642-2434736,2435176-2435245,2435435-2435566, 2435659-2435722,2435786-2435855,2435952-2436036, 2437572-2437628,2437894-2438010,2438267-2438337, 2438703-2439045 Length = 367 Score = 37.9 bits (84), Expect = 0.008 Identities = 17/30 (56%), Positives = 22/30 (73%), Gaps = 2/30 (6%) Frame = -3 Query: 363 KMLDWNEIT--DLPNKRPDVILGADIVYDP 280 K L W E + DL + RPD++LGADI+YDP Sbjct: 234 KYLSWEETSESDLWDCRPDLVLGADIIYDP 263 >10_08_1052 - 22567937-22568329,22568436-22568669,22568787-22569111, 22569239-22569484,22569576-22569916,22570070-22570150, 22570275-22570394,22570549-22570650,22570900-22571035, 22571210-22571362,22572605-22572906 Length = 810 Score = 29.9 bits (64), Expect = 2.0 Identities = 16/39 (41%), Positives = 23/39 (58%) Frame = +1 Query: 112 HLLVALIFHNENYRFPKLVKNFQRLTHFL*YWRYKCSRH 228 H L +N N R+ KLVK +RL ++L Y++ K RH Sbjct: 226 HYLGQQAVYNAN-RYAKLVKKKERLQNWLDYYQLKFERH 263 >02_01_0151 + 1067067-1067222,1067586-1067690,1067904-1067990, 1068071-1068121,1068265-1068291,1068292-1068385, 1068610-1068845 Length = 251 Score = 29.5 bits (63), Expect = 2.7 Identities = 15/25 (60%), Positives = 19/25 (76%), Gaps = 1/25 (4%) Frame = -3 Query: 354 DWNEIT-DLPNKRPDVILGADIVYD 283 +W+E T DL PDVILGAD++YD Sbjct: 150 EWDEPTFDL---HPDVILGADVLYD 171 >09_04_0292 - 16436918-16439233 Length = 771 Score = 28.7 bits (61), Expect = 4.7 Identities = 16/42 (38%), Positives = 26/42 (61%), Gaps = 1/42 (2%) Frame = -2 Query: 676 VASLDTKTSSVL-SFRPTTTTIINIVLSVYKMRTTMCQNVIA 554 V SL T SSVL +RP+TT +NI++ + + + + V+A Sbjct: 354 VTSLFTLFSSVLLHYRPSTTAKVNIIIHSFNLDLFVTRLVVA 395 >08_02_1335 - 26226784-26227015,26227493-26228474,26229021-26230686 Length = 959 Score = 28.7 bits (61), Expect = 4.7 Identities = 10/32 (31%), Positives = 20/32 (62%) Frame = +2 Query: 269 FSIEGSYTISAPSITSGLLFGRSVISFQSNIL 364 F E T+SAP++ G++FG+ + +S ++ Sbjct: 301 FKCEFDLTLSAPTVEQGMVFGKELFGQESGLV 332 >04_04_0097 - 22782031-22782122,22782504-22782570,22782769-22782861, 22782981-22783034,22783163-22783214,22783346-22783413, 22783532-22783711,22783843-22783935,22784585-22784665, 22785011-22785091,22785204-22785331,22786502-22786643 Length = 376 Score = 27.9 bits (59), Expect = 8.2 Identities = 14/24 (58%), Positives = 18/24 (75%), Gaps = 4/24 (16%) Frame = +2 Query: 209 DINVHVI----FSVTEYFQSLQSG 268 DIN H+I FSVTE+F+S +SG Sbjct: 283 DINEHIILSNQFSVTEHFRSSESG 306 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,243,123 Number of Sequences: 37544 Number of extensions: 309278 Number of successful extensions: 803 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 789 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 802 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1792053856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -