BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= tesS0982
(648 letters)
Database: mosquito
2352 sequences; 563,979 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 24 3.6
>AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1
precursor protein.
Length = 1623
Score = 24.2 bits (50), Expect = 3.6
Identities = 12/30 (40%), Positives = 17/30 (56%), Gaps = 1/30 (3%)
Frame = +1
Query: 85 CPKNTEHRA-RHAGKCACCPACVTLLGEGA 171
C + E++ RH G C CPAC L+ + A
Sbjct: 1016 CDRCKENKYDRHQG-CLDCPACYNLVQDAA 1044
Database: mosquito
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 563,979
Number of sequences in database: 2352
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 700,308
Number of Sequences: 2352
Number of extensions: 15577
Number of successful extensions: 8
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 63977715
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -