BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0980 (585 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_23517| Best HMM Match : WD40 (HMM E-Value=0) 31 0.91 SB_13777| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_1398| Best HMM Match : fn3 (HMM E-Value=0.0034) 28 6.4 >SB_23517| Best HMM Match : WD40 (HMM E-Value=0) Length = 860 Score = 30.7 bits (66), Expect = 0.91 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = -2 Query: 578 WFRSWCWFRSWCWIRSRSRKW 516 WF+ W + CWIR SR W Sbjct: 519 WFKCWIQLVNGCWIRLMSRLW 539 >SB_13777| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 27.9 bits (59), Expect = 6.4 Identities = 10/27 (37%), Positives = 18/27 (66%) Frame = +1 Query: 34 NIDVSRTNKKQGLFYIKN*QFTQGSAL 114 N+ +SR NK+Q Y +N +F G+++ Sbjct: 72 NLKISRVNKRQACIYNQNFKFADGASV 98 >SB_1398| Best HMM Match : fn3 (HMM E-Value=0.0034) Length = 2245 Score = 27.9 bits (59), Expect = 6.4 Identities = 11/39 (28%), Positives = 15/39 (38%) Frame = -2 Query: 572 RSWCWFRSWCWIRSRSRKWSCPXXXXXXXARNRLFWIWT 456 R W W+R IR R + W C + W W+ Sbjct: 463 RVWLWYRLLLCIRIRCKPWWCSIKIEWCSKKTFKEWWWS 501 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,356,008 Number of Sequences: 59808 Number of extensions: 166250 Number of successful extensions: 492 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 440 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 491 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1410146228 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -