BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0965 (598 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY344832-1|AAR05803.1| 333|Anopheles gambiae ICHIT protein. 24 3.2 AY344831-1|AAR05802.1| 333|Anopheles gambiae ICHIT protein. 24 3.2 AF117752-1|AAD38338.1| 155|Anopheles gambiae serine protease 2A... 24 3.2 AM085517-1|CAJ30215.1| 339|Anopheles gambiae putative angiotens... 23 7.5 AY334011-1|AAR01136.1| 188|Anopheles gambiae beta-tubulin protein. 23 9.9 AY334010-1|AAR01135.1| 188|Anopheles gambiae beta-tubulin protein. 23 9.9 AY334009-1|AAR01134.1| 188|Anopheles gambiae beta-tubulin protein. 23 9.9 AY334008-1|AAR01133.1| 188|Anopheles gambiae beta-tubulin protein. 23 9.9 >AY344832-1|AAR05803.1| 333|Anopheles gambiae ICHIT protein. Length = 333 Score = 24.2 bits (50), Expect = 3.2 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = -3 Query: 368 IPSKMEPKIPGPSSTDKGFPVRSTGSPTVT 279 + +K EP+ PG +T P +T PT T Sbjct: 84 VNAKCEPQSPGDQTTTTLRPATTTLRPTTT 113 >AY344831-1|AAR05802.1| 333|Anopheles gambiae ICHIT protein. Length = 333 Score = 24.2 bits (50), Expect = 3.2 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = -3 Query: 368 IPSKMEPKIPGPSSTDKGFPVRSTGSPTVT 279 + +K EP+ PG +T P +T PT T Sbjct: 84 VNAKCEPQSPGDQTTTTLRPATTTLRPTTT 113 >AF117752-1|AAD38338.1| 155|Anopheles gambiae serine protease 2A protein. Length = 155 Score = 24.2 bits (50), Expect = 3.2 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = +1 Query: 142 TRRHCRKDVRICYVRVGPCRLQ*TRR*DYPS*R*HXH 252 T HC KD+ V +G +L T + +Y + H H Sbjct: 4 TAAHCLKDLNPVTVEIGFIQLSDTEKDEYEIKQVHLH 40 >AM085517-1|CAJ30215.1| 339|Anopheles gambiae putative angiotensin converting enzymeprecursor protein. Length = 339 Score = 23.0 bits (47), Expect = 7.5 Identities = 13/42 (30%), Positives = 18/42 (42%) Frame = -1 Query: 157 GSDDGSRYGEDISEPLLILLIGDRPQTAFARHFELVILYPRR 32 G + Y D+ PLL GDR + + E +LY R Sbjct: 143 GDRSPNPYVSDVDNPLLYRDGGDRNRNRYVSDVENPLLYRDR 184 >AY334011-1|AAR01136.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 22.6 bits (46), Expect = 9.9 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +3 Query: 414 TSPRVSTCLPWPGRLTGNL 470 T V+TCL +PG+L +L Sbjct: 128 TMSGVTTCLRFPGQLNADL 146 >AY334010-1|AAR01135.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 22.6 bits (46), Expect = 9.9 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +3 Query: 414 TSPRVSTCLPWPGRLTGNL 470 T V+TCL +PG+L +L Sbjct: 128 TMSGVTTCLRFPGQLNADL 146 >AY334009-1|AAR01134.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 22.6 bits (46), Expect = 9.9 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +3 Query: 414 TSPRVSTCLPWPGRLTGNL 470 T V+TCL +PG+L +L Sbjct: 128 TMSGVTTCLRFPGQLNADL 146 >AY334008-1|AAR01133.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 22.6 bits (46), Expect = 9.9 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +3 Query: 414 TSPRVSTCLPWPGRLTGNL 470 T V+TCL +PG+L +L Sbjct: 128 TMSGVTTCLRFPGQLNADL 146 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 654,169 Number of Sequences: 2352 Number of extensions: 13559 Number of successful extensions: 37 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 34 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 37 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 57609459 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -