BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0965 (598 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 23 3.0 AB050744-1|BAB17753.1| 238|Apis mellifera period protein protein. 23 3.0 AY703685-1|AAU12681.1| 200|Apis mellifera abdominal-A protein. 21 6.9 DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 21 9.2 AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter... 21 9.2 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 22.6 bits (46), Expect = 3.0 Identities = 11/34 (32%), Positives = 15/34 (44%) Frame = +3 Query: 441 PWPGRLTGNLTH*XLRSGPTSPVRFVWYCTREHS 542 PW +L + + GP +P F C EHS Sbjct: 397 PWTKKLEFVVGQHRILKGPANPDIFRVSCATEHS 430 >AB050744-1|BAB17753.1| 238|Apis mellifera period protein protein. Length = 238 Score = 22.6 bits (46), Expect = 3.0 Identities = 11/34 (32%), Positives = 15/34 (44%) Frame = +3 Query: 441 PWPGRLTGNLTH*XLRSGPTSPVRFVWYCTREHS 542 PW +L + + GP +P F C EHS Sbjct: 103 PWTKKLEFVVGQHRILKGPANPDIFRVSCATEHS 136 >AY703685-1|AAU12681.1| 200|Apis mellifera abdominal-A protein. Length = 200 Score = 21.4 bits (43), Expect = 6.9 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = -2 Query: 177 ADPDIFSAVTTGPDTAKTYPNLSS 106 A+P A TT P TA +LS+ Sbjct: 22 ANPGTIQACTTSPATASLESSLSA 45 >DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. Length = 630 Score = 21.0 bits (42), Expect = 9.2 Identities = 14/44 (31%), Positives = 19/44 (43%) Frame = +2 Query: 122 YVFAVSGPVVTAEKMSGSAMYELVRVGYNELVGEIIXLEGDMXT 253 Y+F G V A YE+ R +L+ EI+ E D T Sbjct: 407 YLFLAVGIVGGACSDVEQNFYEVARNKKKDLLKEILERENDSGT 450 >AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter Am-EAAT protein. Length = 543 Score = 21.0 bits (42), Expect = 9.2 Identities = 16/59 (27%), Positives = 24/59 (40%) Frame = +2 Query: 98 EENEERFGYVFAVSGPVVTAEKMSGSAMYELVRVGYNELVGEIIXLEGDMXTTRYTKKL 274 EEN + V V M G+A+YE V + + I G++ T +T L Sbjct: 375 EENNKIDSRVTRFVVAVGATVNMDGTALYEAVAAIFIAQMNGISLGIGEVITVSFTATL 433 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 177,942 Number of Sequences: 438 Number of extensions: 3824 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17482179 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -