BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0962 (648 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. 22 4.4 DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex det... 22 5.9 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 21 7.8 >AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. Length = 316 Score = 22.2 bits (45), Expect = 4.4 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +3 Query: 552 IWTNSYYNVLNSEPLCVCEKHSH 620 I T Y N+LNSE KHS+ Sbjct: 96 IQTEKYSNMLNSEKHASFLKHSN 118 >DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 21.8 bits (44), Expect = 5.9 Identities = 11/33 (33%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = +1 Query: 445 NYYNYGFHLIIFINYLKLIKI-LFISIYISKEP 540 NY NY L INY++ I + + + +Y P Sbjct: 100 NYNNYNKKLYYNINYIEQIPVPVPVPVYCGNFP 132 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 21.4 bits (43), Expect = 7.8 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +2 Query: 191 LARKPSKLNKLTQNLITLLTFPDA 262 L R P L K+ QN T PDA Sbjct: 895 LIRSPDTLRKIAQNRGTNPLAPDA 918 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 155,523 Number of Sequences: 438 Number of extensions: 2671 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19560480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -