BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0961 (648 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U39855-1|AAA81080.3| 615|Caenorhabditis elegans Hypothetical pr... 28 5.0 AY125085-1|AAM94369.1| 1113|Caenorhabditis elegans regulatory cy... 28 6.6 AF024497-5|AAO21477.1| 871|Caenorhabditis elegans Defective in ... 28 6.6 AF024497-4|AAO21479.1| 807|Caenorhabditis elegans Defective in ... 28 6.6 AF024497-3|AAO21478.1| 1036|Caenorhabditis elegans Defective in ... 28 6.6 AF024497-2|AAB70342.2| 1113|Caenorhabditis elegans Defective in ... 28 6.6 >U39855-1|AAA81080.3| 615|Caenorhabditis elegans Hypothetical protein F18G5.4 protein. Length = 615 Score = 28.3 bits (60), Expect = 5.0 Identities = 15/41 (36%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = -2 Query: 500 RNKTRACGSQSPLLHISAVSLLLIYTQDAPKLCG-VIRETF 381 +N R C PL+HI A S++ D + G IRE F Sbjct: 484 QNANRECECMDPLVHIYAESIMSCLAADTKPMNGSTIREDF 524 >AY125085-1|AAM94369.1| 1113|Caenorhabditis elegans regulatory cytoplasmic polyA polymeraseprotein. Length = 1113 Score = 27.9 bits (59), Expect = 6.6 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = -2 Query: 257 PFLRLNMSSPFDAVITDFDCTKKIVYTN 174 P LR+N ++PFD + D + + N Sbjct: 652 PILRINFAAPFDDITVDLNANNSVAIRN 679 >AF024497-5|AAO21477.1| 871|Caenorhabditis elegans Defective in germ line developmentprotein 2, isoform b protein. Length = 871 Score = 27.9 bits (59), Expect = 6.6 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = -2 Query: 257 PFLRLNMSSPFDAVITDFDCTKKIVYTN 174 P LR+N ++PFD + D + + N Sbjct: 410 PILRINFAAPFDDITVDLNANNSVAIRN 437 >AF024497-4|AAO21479.1| 807|Caenorhabditis elegans Defective in germ line developmentprotein 2, isoform d protein. Length = 807 Score = 27.9 bits (59), Expect = 6.6 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = -2 Query: 257 PFLRLNMSSPFDAVITDFDCTKKIVYTN 174 P LR+N ++PFD + D + + N Sbjct: 346 PILRINFAAPFDDITVDLNANNSVAIRN 373 >AF024497-3|AAO21478.1| 1036|Caenorhabditis elegans Defective in germ line developmentprotein 2, isoform c protein. Length = 1036 Score = 27.9 bits (59), Expect = 6.6 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = -2 Query: 257 PFLRLNMSSPFDAVITDFDCTKKIVYTN 174 P LR+N ++PFD + D + + N Sbjct: 575 PILRINFAAPFDDITVDLNANNSVAIRN 602 >AF024497-2|AAB70342.2| 1113|Caenorhabditis elegans Defective in germ line developmentprotein 2, isoform a protein. Length = 1113 Score = 27.9 bits (59), Expect = 6.6 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = -2 Query: 257 PFLRLNMSSPFDAVITDFDCTKKIVYTN 174 P LR+N ++PFD + D + + N Sbjct: 652 PILRINFAAPFDDITVDLNANNSVAIRN 679 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,689,892 Number of Sequences: 27780 Number of extensions: 307963 Number of successful extensions: 732 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 721 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 732 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1434198608 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -