BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0960 (538 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0441 - 8517501-8517701,8518004-8518139,8519995-8520107,852... 30 1.3 04_04_1356 + 32854585-32854832,32854948-32855148,32855270-328554... 29 2.3 08_02_0099 + 12343518-12343678,12344193-12344393,12344669-123448... 28 4.1 03_05_0712 - 27057858-27057941,27058093-27058182,27058268-270583... 28 4.1 02_03_0356 + 18073794-18074052,18074054-18074163 28 5.4 >03_02_0441 - 8517501-8517701,8518004-8518139,8519995-8520107, 8520189-8520284,8520376-8520590,8520675-8520797, 8520887-8520917,8521020-8521079,8521951-8522106, 8522185-8522274,8522347-8522562,8522671-8522805, 8522898-8523401,8523485-8523700,8524411-8524456, 8524542-8524678,8525059-8525191,8526084-8526358 Length = 960 Score = 29.9 bits (64), Expect = 1.3 Identities = 15/54 (27%), Positives = 23/54 (42%) Frame = +1 Query: 139 HNDTMEIYSDMLLKCFSIDITAVELGDTKRLICMTCISSCETASLSGFKLKPPY 300 H D +E D+L +I I + D K ++ C S + GF + PY Sbjct: 655 HADVLEKQKDILDTVMNIYIKTMREDDDKEVVAQACTSLADIVRDCGFAIIEPY 708 >04_04_1356 + 32854585-32854832,32854948-32855148,32855270-32855447, 32856389-32856651,32856800-32857040,32857317-32858456, 32858856-32858993 Length = 802 Score = 29.1 bits (62), Expect = 2.3 Identities = 15/50 (30%), Positives = 25/50 (50%), Gaps = 1/50 (2%) Frame = -3 Query: 197 MSMEKH-FNNISEYISMVSLCLCPVNILFTAPSLRHKLHTPSSGNISTII 51 M ++ H F N S Y + ++ L ++LF LRH L P S + ++ Sbjct: 713 MFVDLHPFTNTSPYTVVETMSLAKAHVLFREVGLRHLLVLPKSSKRAPVV 762 >08_02_0099 + 12343518-12343678,12344193-12344393,12344669-12344846, 12347201-12347463,12347596-12347874,12348045-12349182, 12349303-12349473 Length = 796 Score = 28.3 bits (60), Expect = 4.1 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 1/50 (2%) Frame = -3 Query: 197 MSMEKH-FNNISEYISMVSLCLCPVNILFTAPSLRHKLHTPSSGNISTII 51 M ++ H F N S Y + ++ L +LF LRH L P S + S ++ Sbjct: 696 MYVDLHPFTNTSPYTVVETMSLAKALVLFREVGLRHLLVVPKSCDRSPVV 745 >03_05_0712 - 27057858-27057941,27058093-27058182,27058268-27058384, 27059759-27059866,27060314-27060406,27060499-27060669, 27061505-27061757,27061860-27062138,27062939-27063273, 27063364-27064332,27064711-27065182,27065243-27065291, 27066564-27066804,27067606-27067695,27068172-27068294, 27068365-27068418 Length = 1175 Score = 28.3 bits (60), Expect = 4.1 Identities = 12/33 (36%), Positives = 22/33 (66%), Gaps = 1/33 (3%) Frame = +1 Query: 220 TKRLICMTCISSCETASLSGFK-LKPPYTLWRI 315 T+R + + ++SC A L GFK L+P +T+ ++ Sbjct: 1087 TERCMLLKFVTSCSRAPLLGFKYLQPSFTIHKV 1119 >02_03_0356 + 18073794-18074052,18074054-18074163 Length = 122 Score = 27.9 bits (59), Expect = 5.4 Identities = 20/59 (33%), Positives = 26/59 (44%) Frame = -1 Query: 427 RACXXA*SXISLATTSPSASVLRSSKAPCDSTFSNLNVSSRVYKEAST*TLKATQSRNS 251 R+ A S L SPSA V S P STF NLN +E++ T +R + Sbjct: 49 RSLASACSKSKLTGLSPSAGVSPSRCPPTRSTFPNLNCMRSSKRESTRPFANVTIARRA 107 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,108,524 Number of Sequences: 37544 Number of extensions: 241516 Number of successful extensions: 561 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 552 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 560 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1186491600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -