BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0955 (598 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_02_0140 + 5759374-5759567,5759972-5760194 28 4.9 06_03_0499 + 21461608-21463427,21463517-21463627,21463867-214641... 27 8.6 >10_02_0140 + 5759374-5759567,5759972-5760194 Length = 138 Score = 28.3 bits (60), Expect = 4.9 Identities = 12/43 (27%), Positives = 23/43 (53%) Frame = -1 Query: 445 LCIQXPFDHSRNCSVNIYPKLVXRIVDLFKSAAETFHKDKXPN 317 +CI+ PF+ S + + + + + + F+ AAE H D P+ Sbjct: 82 ICIEDPFETSHDLGRVVDNRSIWALREEFERAAEILHLDPNPS 124 >06_03_0499 + 21461608-21463427,21463517-21463627,21463867-21464143, 21464265-21464353,21464508-21464595,21464698-21464907, 21464985-21465110,21465429-21465620,21466532-21467188 Length = 1189 Score = 27.5 bits (58), Expect = 8.6 Identities = 11/39 (28%), Positives = 20/39 (51%) Frame = -1 Query: 166 LQNEGKDNLFFFFYKMIKYACIMIKSKIKFIVTNVCSVY 50 L +G NLFF +Y+++ + + S + N+C Y Sbjct: 975 LYQQGPRNLFFDWYRILGWMANGLYSSLAIFFLNICIFY 1013 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,013,350 Number of Sequences: 37544 Number of extensions: 230864 Number of successful extensions: 467 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 459 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 466 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1423789920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -