BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0955 (598 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U80226-1|AAB38510.1| 500|Homo sapiens gamma-aminobutyric acid t... 30 7.2 >U80226-1|AAB38510.1| 500|Homo sapiens gamma-aminobutyric acid transaminase protein. Length = 500 Score = 29.9 bits (64), Expect = 7.2 Identities = 27/90 (30%), Positives = 43/90 (47%), Gaps = 1/90 (1%) Frame = -1 Query: 409 CSVNIYPKLVXRI-VDLFKSAAETFHKDKXPNFLREILQKNTENIYQEVKYKQERRSFYI 233 C + K + +I + F TF + K P L E +++N + +E + +E I Sbjct: 224 CLATTHSKAIHKIDIPSFDWPIATFPRLKYP--LEEFVKENQQ---EEARCLEEVEDL-I 277 Query: 232 IKYRKFNLTSFGIIIITAIGAELQNEGKDN 143 +KYRK T GII+ +Q+EG DN Sbjct: 278 VKYRKKKKTVAGIIV-----EPIQSEGGDN 302 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 73,894,865 Number of Sequences: 237096 Number of extensions: 1450308 Number of successful extensions: 2089 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 2079 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2089 length of database: 76,859,062 effective HSP length: 86 effective length of database: 56,468,806 effective search space used: 6324506272 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -