BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0950 (500 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_03_0604 - 16132173-16132391,16132488-16132556,16132824-161328... 35 0.042 07_01_1036 + 9021395-9021658,9024214-9024690 29 2.8 >05_03_0604 - 16132173-16132391,16132488-16132556,16132824-16132898, 16132981-16133113,16133188-16133297,16133360-16133407, 16133657-16133983,16135006-16135233,16135360-16135689, 16135780-16136586 Length = 781 Score = 34.7 bits (76), Expect = 0.042 Identities = 22/54 (40%), Positives = 28/54 (51%), Gaps = 2/54 (3%) Frame = +2 Query: 266 VLSVCSPYFXXMFK--MNPTQHPIVFXTDVSHSALRDLLQFMYQGEVNVKXEEL 421 +LS+ S F MF M + VF DV A L+QFMY GE+ V EE+ Sbjct: 369 ILSLWSMTFDKMFTNGMKESSASNVFFEDVPVEAFFLLIQFMYSGELKVDIEEI 422 >07_01_1036 + 9021395-9021658,9024214-9024690 Length = 246 Score = 28.7 bits (61), Expect = 2.8 Identities = 18/56 (32%), Positives = 30/56 (53%), Gaps = 2/56 (3%) Frame = +2 Query: 266 VLSVCSPYFXXMFK--MNPTQHPIVFXTDVSHSALRDLLQFMYQGEVNVKXEELAS 427 +L+ SP F M + M ++ I+ DVS+ LR + +MY E + E++AS Sbjct: 87 ILASRSPVFRAMLENEMEESRSGIIKIYDVSYDVLRAFVHYMYTAEA-LLDEQMAS 141 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,787,825 Number of Sequences: 37544 Number of extensions: 178757 Number of successful extensions: 327 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 322 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 327 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1059318940 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -