BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0947 (548 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF283275-1|AAG15376.1| 133|Anopheles gambiae small heat shock p... 93 7e-21 AJ459960-1|CAD31059.1| 696|Anopheles gambiae prophenoloxidase 7... 23 5.0 AF007166-1|AAB62929.1| 360|Anopheles gambiae serine protease 14... 23 5.0 AY324307-1|AAQ89692.1| 154|Anopheles gambiae insulin-like pepti... 23 6.6 >AF283275-1|AAG15376.1| 133|Anopheles gambiae small heat shock protein protein. Length = 133 Score = 92.7 bits (220), Expect = 7e-21 Identities = 39/61 (63%), Positives = 48/61 (78%) Frame = +2 Query: 257 SIKSDKXKFQVNLDVQHFAPEEISVKTADGYIVVEGKHEEKKDQHGYISRQFTRRYALPE 436 ++ K KFQ+NLDVQ F+PEEISVK D ++VEGKHEEK+D HGY+SR F RRY LP+ Sbjct: 7 AVNISKDKFQINLDVQQFSPEEISVKYVDNCVLVEGKHEEKQDDHGYVSRHFVRRYMLPK 66 Query: 437 G 439 G Sbjct: 67 G 67 Score = 31.1 bits (67), Expect = 0.025 Identities = 14/27 (51%), Positives = 18/27 (66%) Frame = +1 Query: 466 LSSDGVLSVIAPRKGRQQWKGXRKIPI 546 LSSDG+L++ PRK +Q R IPI Sbjct: 77 LSSDGILTITCPRKEIEQKNEERSIPI 103 >AJ459960-1|CAD31059.1| 696|Anopheles gambiae prophenoloxidase 7 protein. Length = 696 Score = 23.4 bits (48), Expect = 5.0 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = -1 Query: 482 TPSEDSRTPQIQPYSPPAKRS 420 TP ++ RTP +PY P RS Sbjct: 271 TPLDNLRTPIPEPYYPKILRS 291 >AF007166-1|AAB62929.1| 360|Anopheles gambiae serine protease 14D protein. Length = 360 Score = 23.4 bits (48), Expect = 5.0 Identities = 12/43 (27%), Positives = 18/43 (41%) Frame = +1 Query: 73 KMSLIPWLLXYEIERPRRLMDQHFGLGLTPEDFLSAAAGPLVS 201 K+ PW E E+P H G + E ++ AA + S Sbjct: 115 KIDEFPWTALIEYEKPNGRFGFHCGGSVINERYILTAAHCITS 157 >AY324307-1|AAQ89692.1| 154|Anopheles gambiae insulin-like peptide 1 precursor protein. Length = 154 Score = 23.0 bits (47), Expect = 6.6 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = -2 Query: 493 LQTTHHLKTAGLHRFSRTALRQSVA 419 L T HL T H F R RQ VA Sbjct: 112 LVTLQHLNTHEEHNFHRRVRRQVVA 136 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 565,073 Number of Sequences: 2352 Number of extensions: 11487 Number of successful extensions: 17 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 50881347 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -