BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0945 (419 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein pr... 23 1.2 AM292378-1|CAL23190.2| 387|Tribolium castaneum gustatory recept... 23 1.6 AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 20 8.5 AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory recept... 20 8.5 >AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein protein. Length = 392 Score = 23.0 bits (47), Expect = 1.2 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = +2 Query: 179 AVLRSSVCLGQLSSEMAYKTASFFNRFDSLPVP 277 A L+SS C LSS + SF D P+P Sbjct: 26 ATLQSSACTDDLSSCWSEDMGSFSLPLDLEPLP 58 >AM292378-1|CAL23190.2| 387|Tribolium castaneum gustatory receptor candidate 57 protein. Length = 387 Score = 22.6 bits (46), Expect = 1.6 Identities = 13/48 (27%), Positives = 20/48 (41%), Gaps = 2/48 (4%) Frame = +2 Query: 137 VLHAALWYVTNMKIAVLRSSVCLGQLSSEMAYKTASFF--NRFDSLPV 274 V+ ALW T + +L + C G S F+ N ++PV Sbjct: 283 VILCALWITTLLLFTILLAYGCAGATSEAEKIAKICFYWLNEIPTMPV 330 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 20.2 bits (40), Expect = 8.5 Identities = 7/20 (35%), Positives = 11/20 (55%) Frame = -2 Query: 214 KLTEANTGAEDRNLHICNIP 155 +L A +N+H C+IP Sbjct: 301 RLGPAGVHLRKKNIHSCHIP 320 >AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory receptor candidate 51 protein. Length = 771 Score = 20.2 bits (40), Expect = 8.5 Identities = 7/20 (35%), Positives = 11/20 (55%) Frame = -3 Query: 195 LERRTAIFIFVTYHRAAWST 136 + ++ IFVTY WS+ Sbjct: 534 ITKQLIFMIFVTYQLYCWSS 553 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 97,562 Number of Sequences: 336 Number of extensions: 1998 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 51 effective length of database: 105,449 effective search space used: 9279512 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -