BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0944 (279 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC285.14 |||TRAPP complex subunit Trs130 |Schizosaccharomyces ... 26 1.1 SPCC63.07 |||tRNA guanylyltransferase |Schizosaccharomyces pombe... 24 3.5 SPAC17H9.08 |||mitochondrial coenzyme A transporter|Schizosaccha... 24 3.5 >SPCC285.14 |||TRAPP complex subunit Trs130 |Schizosaccharomyces pombe|chr 3|||Manual Length = 1150 Score = 25.8 bits (54), Expect = 1.1 Identities = 14/47 (29%), Positives = 21/47 (44%) Frame = -2 Query: 278 HLFFIYTKITIALNTDGCHRRHPRRYVSEFXISSCSTCKW*CTESRG 138 HL+ + +KI+ DG P + F +SCS K E+ G Sbjct: 687 HLYILQSKISQQFQNDGIFACIPIMFGERFYKASCSEIKLSYIENSG 733 >SPCC63.07 |||tRNA guanylyltransferase |Schizosaccharomyces pombe|chr 3|||Manual Length = 261 Score = 24.2 bits (50), Expect = 3.5 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -1 Query: 84 RSKQRLIFKSIKVFTSAFL*NWYEWF 7 R + +L+ +FTSAF+ NW + F Sbjct: 91 RRESKLVSHVCSLFTSAFVFNWPKHF 116 >SPAC17H9.08 |||mitochondrial coenzyme A transporter|Schizosaccharomyces pombe|chr 1|||Manual Length = 326 Score = 24.2 bits (50), Expect = 3.5 Identities = 11/34 (32%), Positives = 16/34 (47%) Frame = -2 Query: 272 FFIYTKITIALNTDGCHRRHPRRYVSEFXISSCS 171 F Y ++ L D H H RR++S +CS Sbjct: 97 FVAYEQVRRVLIRDPEHETHARRFLSGSLAGTCS 130 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 853,622 Number of Sequences: 5004 Number of extensions: 9564 Number of successful extensions: 15 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 2,362,478 effective HSP length: 62 effective length of database: 2,052,230 effective search space used: 61566900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -