BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0944 (279 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY061618-1|AAL29166.1| 775|Drosophila melanogaster SD08238p pro... 27 4.7 AE014298-1265|AAF46439.1| 775|Drosophila melanogaster CG32707-P... 27 4.7 >AY061618-1|AAL29166.1| 775|Drosophila melanogaster SD08238p protein. Length = 775 Score = 26.6 bits (56), Expect = 4.7 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = -2 Query: 278 HLFFIYTKITIALNTDGCHRRHPRRYVSEFXIS 180 H FFI +T ALN HR P +SE +S Sbjct: 661 HSFFIQFSLTAALNYSTQHRMGPLVKLSEATVS 693 >AE014298-1265|AAF46439.1| 775|Drosophila melanogaster CG32707-PA protein. Length = 775 Score = 26.6 bits (56), Expect = 4.7 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = -2 Query: 278 HLFFIYTKITIALNTDGCHRRHPRRYVSEFXIS 180 H FFI +T ALN HR P +SE +S Sbjct: 661 HSFFIQFSLTAALNYSTQHRMGPLVKLSEATVS 693 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,520,654 Number of Sequences: 53049 Number of extensions: 94718 Number of successful extensions: 180 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 176 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 179 length of database: 24,988,368 effective HSP length: 71 effective length of database: 21,221,889 effective search space used: 445659669 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -