BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0939 (299 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_20218| Best HMM Match : Xan_ur_permease (HMM E-Value=0.035) 26 6.5 SB_28221| Best HMM Match : eRF1_3 (HMM E-Value=8.7) 25 8.6 >SB_20218| Best HMM Match : Xan_ur_permease (HMM E-Value=0.035) Length = 242 Score = 25.8 bits (54), Expect = 6.5 Identities = 19/52 (36%), Positives = 20/52 (38%), Gaps = 2/52 (3%) Frame = -1 Query: 245 HRRHPRRYVSEFNISSCSTCKW--*CTESRGRSMGRSKNRRVLHTYSYRDRS 96 H R PR Y ISS C W C RS S + T S R RS Sbjct: 5 HARDPRCYNGRVPISSPYRCDWPNGCVTEVHRSRCHSAHHHADWTCSLRGRS 56 >SB_28221| Best HMM Match : eRF1_3 (HMM E-Value=8.7) Length = 348 Score = 25.4 bits (53), Expect = 8.6 Identities = 15/36 (41%), Positives = 20/36 (55%), Gaps = 3/36 (8%) Frame = -1 Query: 152 MGRSKNRRVLHTYSYR---DRSKG*YLKVSKFSLQR 54 MG+ KNR V SYR +SK +KV K ++ R Sbjct: 1 MGKGKNRSVYRHSSYRTLPTKSKSLRMKVGKSNIPR 36 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,529,647 Number of Sequences: 59808 Number of extensions: 84372 Number of successful extensions: 208 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 191 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 208 length of database: 16,821,457 effective HSP length: 71 effective length of database: 12,575,089 effective search space used: 352102492 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -