BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0936 (618 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory recept... 28 0.072 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 27 0.095 AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nu... 22 3.6 AM292371-1|CAL23183.2| 350|Tribolium castaneum gustatory recept... 22 4.7 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 21 6.3 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 21 6.3 >AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory receptor candidate 5 protein. Length = 522 Score = 27.9 bits (59), Expect = 0.072 Identities = 14/45 (31%), Positives = 25/45 (55%) Frame = -2 Query: 263 QTNQQWLTLVENFSSALKEIGDVENWARSIENDMKIITDTLERAY 129 QT +L L N S+ L + + WA+ I+N +K++ T +A+ Sbjct: 67 QTCLDFLLLALNISTILTTVRKQQQWAQLIQN-LKVVATTKTKAW 110 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 27.5 bits (58), Expect = 0.095 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +2 Query: 101 YCLVSLVLFHMLFLKCL**FSYHFLYFVP 187 YC+ H+LFL C F+ H L++ P Sbjct: 60 YCVSITFNVHLLFLLCSGYFTVHLLFYCP 88 Score = 23.8 bits (49), Expect = 1.2 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +2 Query: 101 YCLVSLVLFHMLFLKCL**FSYHFLYF 181 YC + H+LFL C+ F F+ F Sbjct: 150 YCAFIIFTVHLLFLLCIYHFFCAFIIF 176 Score = 23.8 bits (49), Expect = 1.2 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +2 Query: 104 CLVSLVLFHMLFLKCL**FSYHFLY 178 C H+LFL CL F+ H L+ Sbjct: 184 CAFIFFNMHLLFLLCLDYFTLHLLF 208 >AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nuclear receptor protein. Length = 407 Score = 22.2 bits (45), Expect = 3.6 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = -3 Query: 448 QAKQAAKRVVQEQKRKECITAANDLTQALVDHLN 347 QA +R+++ +KR EC ND ALV + N Sbjct: 178 QADMPLERIIEAEKRVEC----NDPLVALVVNEN 207 >AM292371-1|CAL23183.2| 350|Tribolium castaneum gustatory receptor candidate 50 protein. Length = 350 Score = 21.8 bits (44), Expect = 4.7 Identities = 9/30 (30%), Positives = 15/30 (50%) Frame = +2 Query: 368 LC*IISSCNALLTFLFLYNTFSCLFCLMFF 457 LC + +S FLF+ +TFS ++ Sbjct: 224 LCQVANSIYGFQNFLFVLSTFSICITQFYY 253 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 21.4 bits (43), Expect = 6.3 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +1 Query: 556 NHPSQMAKYIFYNGNHDK*HH 618 NH Q+ KY+ N + K H+ Sbjct: 326 NHNEQLRKYLCKNEDETKNHY 346 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 21.4 bits (43), Expect = 6.3 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +1 Query: 556 NHPSQMAKYIFYNGNHDK*HH 618 NH Q+ KY+ N + K H+ Sbjct: 218 NHNEQLRKYLCKNEDETKNHY 238 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 132,648 Number of Sequences: 336 Number of extensions: 2666 Number of successful extensions: 8 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15770591 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -