BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0936 (618 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containi... 27 0.64 AJ535203-1|CAD59403.1| 1229|Anopheles gambiae SMC1 protein protein. 24 3.4 >AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containing protein I protein. Length = 1340 Score = 26.6 bits (56), Expect = 0.64 Identities = 10/43 (23%), Positives = 23/43 (53%) Frame = -2 Query: 272 KFFQTNQQWLTLVENFSSALKEIGDVENWARSIENDMKIITDT 144 KF + NQ++ ++ NF+S L ++ + +N + ++ T Sbjct: 28 KFIRANQEYTLVISNFNSQLSKVDLLLKLEGETDNGLSVLNVT 70 >AJ535203-1|CAD59403.1| 1229|Anopheles gambiae SMC1 protein protein. Length = 1229 Score = 24.2 bits (50), Expect = 3.4 Identities = 15/65 (23%), Positives = 29/65 (44%), Gaps = 1/65 (1%) Frame = -3 Query: 448 QAKQAAKRVVQEQKRK-ECITAANDLTQALVDHLNVGVAQAYLNQKKLDAEAKLLHQGAI 272 QA+ ++ +++ K K E + + LVD + +A+A + L E +HQ Sbjct: 864 QAEARQRQEIEKDKEKIELMKQEKAAHKTLVDQMEEEMAKARREVQALAKELAAIHQSIA 923 Query: 271 NFSKQ 257 N + Sbjct: 924 NIESR 928 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 575,415 Number of Sequences: 2352 Number of extensions: 11283 Number of successful extensions: 14 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 60553008 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -