BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0935 (538 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC029104-1|AAH29104.1| 792|Homo sapiens CPT1C protein protein. 31 3.4 BC010084-1|AAH10084.1| 330|Homo sapiens family with sequence si... 31 3.4 AK074389-1|BAB85068.1| 507|Homo sapiens actosyltransferase. pr... 31 3.4 AF357970-2|AAL99615.1| 803|Homo sapiens carnitine palmitoyltran... 31 3.4 AF331918-1|AAQ14875.1| 803|Homo sapiens carnitine acyltransfera... 31 3.4 AB208884-1|BAD92121.1| 400|Homo sapiens carnitine palmitoyltran... 31 3.4 >BC029104-1|AAH29104.1| 792|Homo sapiens CPT1C protein protein. Length = 792 Score = 30.7 bits (66), Expect = 3.4 Identities = 20/59 (33%), Positives = 28/59 (47%) Frame = +1 Query: 241 QNIFRHYRVASVLKDHIQYLHQVLHRAFYLVDR*FHSNLTS*HLSVKVPSKSVQPFQRL 417 + IF R+ V KD+I++LH H A + R F S S+ P Q FQR+ Sbjct: 297 EKIFNTTRIPGVQKDYIRHLHDSQHVAVFHRGRFFRMGTHS-RNSLLSPRALEQQFQRI 354 >BC010084-1|AAH10084.1| 330|Homo sapiens family with sequence similarity 86, member A protein. Length = 330 Score = 30.7 bits (66), Expect = 3.4 Identities = 15/40 (37%), Positives = 22/40 (55%), Gaps = 2/40 (5%) Frame = -1 Query: 367 VKMLDWNEIT--DLPNKRPDVILGADIVYDPSILKPLCNV 254 V LDW+ T L +PDV++ AD++Y P + L V Sbjct: 223 VAQLDWDVATVHQLSAFQPDVVIAADVLYCPEAIMSLVGV 262 >AK074389-1|BAB85068.1| 507|Homo sapiens actosyltransferase. protein. Length = 507 Score = 30.7 bits (66), Expect = 3.4 Identities = 20/59 (33%), Positives = 28/59 (47%) Frame = +1 Query: 241 QNIFRHYRVASVLKDHIQYLHQVLHRAFYLVDR*FHSNLTS*HLSVKVPSKSVQPFQRL 417 + IF R+ V KD+I++LH H A + R F S S+ P Q FQR+ Sbjct: 12 EKIFNTTRIPGVQKDYIRHLHDSQHVAVFHRGRFFRMGTHS-RNSLLSPRALEQQFQRI 69 >AF357970-2|AAL99615.1| 803|Homo sapiens carnitine palmitoyltransferase IC protein. Length = 803 Score = 30.7 bits (66), Expect = 3.4 Identities = 20/59 (33%), Positives = 28/59 (47%) Frame = +1 Query: 241 QNIFRHYRVASVLKDHIQYLHQVLHRAFYLVDR*FHSNLTS*HLSVKVPSKSVQPFQRL 417 + IF R+ V KD+I++LH H A + R F S S+ P Q FQR+ Sbjct: 308 EKIFNTTRIPGVQKDYIRHLHDSQHVAVFHRGRFFRMGTHS-RNSLLSPRALEQQFQRI 365 >AF331918-1|AAQ14875.1| 803|Homo sapiens carnitine acyltransferase-like protein 1 protein. Length = 803 Score = 30.7 bits (66), Expect = 3.4 Identities = 20/59 (33%), Positives = 28/59 (47%) Frame = +1 Query: 241 QNIFRHYRVASVLKDHIQYLHQVLHRAFYLVDR*FHSNLTS*HLSVKVPSKSVQPFQRL 417 + IF R+ V KD+I++LH H A + R F S S+ P Q FQR+ Sbjct: 308 EKIFNTTRIPGVQKDYIRHLHDSQHVAVFHRGRFFRMGTHS-RNSLLSPRALEQQFQRI 365 >AB208884-1|BAD92121.1| 400|Homo sapiens carnitine palmitoyltransferase 1C variant protein. Length = 400 Score = 30.7 bits (66), Expect = 3.4 Identities = 20/59 (33%), Positives = 28/59 (47%) Frame = +1 Query: 241 QNIFRHYRVASVLKDHIQYLHQVLHRAFYLVDR*FHSNLTS*HLSVKVPSKSVQPFQRL 417 + IF R+ V KD+I++LH H A + R F S S+ P Q FQR+ Sbjct: 94 EKIFNTTRIPGVQKDYIRHLHDSQHVAVFHRGRFFRMGTHS-RNSLLSPRALEQQFQRI 151 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 68,855,922 Number of Sequences: 237096 Number of extensions: 1350334 Number of successful extensions: 2118 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2096 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2118 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 5273648886 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -