BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0935 (538 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g27400.1 68418.m03271 expressed protein hypothetical proteins... 38 0.003 At3g50850.1 68416.m05568 expressed protein 30 1.1 At3g46290.1 68416.m05010 protein kinase, putative similar to rec... 29 2.0 At1g63855.3 68414.m07228 expressed protein 29 2.0 At1g63855.1 68414.m07229 expressed protein 29 2.0 At1g08125.1 68414.m00891 Expressed protein 29 2.6 At3g42730.1 68416.m04462 Ulp1 protease family protein contains P... 28 4.5 At3g24230.1 68416.m03041 pectate lyase family protein similar to... 28 4.5 At3g48460.1 68416.m05290 GDSL-motif lipase/hydrolase family prot... 27 6.0 At4g24880.1 68417.m03560 expressed protein 27 7.9 At3g24670.1 68416.m03097 pectate lyase family protein similar to... 27 7.9 At1g27660.1 68414.m03381 ethylene-responsive protein -related co... 27 7.9 At1g19980.1 68414.m02503 cytomatrix protein-related contains wea... 27 7.9 >At5g27400.1 68418.m03271 expressed protein hypothetical proteins - different species Length = 369 Score = 38.3 bits (85), Expect = 0.003 Identities = 15/29 (51%), Positives = 21/29 (72%) Frame = -1 Query: 340 TDLPNKRPDVILGADIVYDPSILKPLCNV 254 ++L RPD++LGAD++YDPS L L V Sbjct: 249 SELSQYRPDIVLGADVIYDPSCLPHLLRV 277 >At3g50850.1 68416.m05568 expressed protein Length = 251 Score = 29.9 bits (64), Expect = 1.1 Identities = 15/47 (31%), Positives = 26/47 (55%), Gaps = 2/47 (4%) Frame = -1 Query: 367 VKMLDWNEITDLPN--KRPDVILGADIVYDPSILKPLCNV*KYSVTE 233 V L W EI D+ + + D+IL +D+VY + +PL ++ + E Sbjct: 146 VASLRWGEIDDVESLGQNVDLILASDVVYHVHLYEPLLKTLRFLLLE 192 >At3g46290.1 68416.m05010 protein kinase, putative similar to receptor-like protein kinase [Catharanthus roseus] gi|1644291|emb|CAA97692 Length = 830 Score = 29.1 bits (62), Expect = 2.0 Identities = 18/60 (30%), Positives = 28/60 (46%), Gaps = 2/60 (3%) Frame = +3 Query: 225 VIFSVTEYFQTLQSGFSIEGSYTISAPSITSGLLFGRSVIS--FQSNILTSVSESPVKIG 398 ++ S + GF+ +Y I+ S T+G L GR +S S +LTS E +G Sbjct: 10 ILISTISILLCICHGFTPVDNYLINCGSPTNGTLMGRIFLSDKLSSKLLTSSKEILASVG 69 >At1g63855.3 68414.m07228 expressed protein Length = 196 Score = 29.1 bits (62), Expect = 2.0 Identities = 14/29 (48%), Positives = 20/29 (68%), Gaps = 2/29 (6%) Frame = -1 Query: 358 LDWNEITDLP--NKRPDVILGADIVYDPS 278 L W + D P + RP++ILGAD++YD S Sbjct: 113 LTWG-VWDAPILDLRPNIILGADVLYDSS 140 >At1g63855.1 68414.m07229 expressed protein Length = 159 Score = 29.1 bits (62), Expect = 2.0 Identities = 14/29 (48%), Positives = 20/29 (68%), Gaps = 2/29 (6%) Frame = -1 Query: 358 LDWNEITDLP--NKRPDVILGADIVYDPS 278 L W + D P + RP++ILGAD++YD S Sbjct: 113 LTWG-VWDAPILDLRPNIILGADVLYDSS 140 >At1g08125.1 68414.m00891 Expressed protein Length = 315 Score = 28.7 bits (61), Expect = 2.6 Identities = 13/37 (35%), Positives = 19/37 (51%), Gaps = 2/37 (5%) Frame = -1 Query: 367 VKMLDWNEITDLPNKRP--DVILGADIVYDPSILKPL 263 V LDW + P D ++G D+VY +L+PL Sbjct: 126 VAELDWGNEDHITAVEPPFDYVIGTDVVYSEQLLEPL 162 >At3g42730.1 68416.m04462 Ulp1 protease family protein contains Pfam profile PF02902: Ulp1 protease family, C-terminal catalytic domain; similar to At3g24380, At5g36840, At5g35010, At3g42740, At4g05290, At2g14770, At3g43390, At2g05560, At4g08880, At1g34730, At1g27790, At1g34740, At1g27780, At5g36850, At1g52020, At3g24390, At4g05280, At1g25886, At4g03300 Length = 1314 Score = 27.9 bits (59), Expect = 4.5 Identities = 20/55 (36%), Positives = 26/55 (47%), Gaps = 2/55 (3%) Frame = -1 Query: 427 VELLISGTAGPILTGLSLTDVKMLDWNEITDL--PNKRPDVILGADIVYDPSILK 269 +ELL G LT + TD+ D+ +KR D G DIVY P +LK Sbjct: 1152 LELLAFGHPFSELTTIRETDMVFYRQKYSVDIYEHSKREDGTRGRDIVYRPDVLK 1206 >At3g24230.1 68416.m03041 pectate lyase family protein similar to pectate lyase GP:14531296 from [Fragaria x ananassa] Length = 452 Score = 27.9 bits (59), Expect = 4.5 Identities = 17/55 (30%), Positives = 27/55 (49%), Gaps = 3/55 (5%) Frame = +2 Query: 122 VALIFHNENYRFPKLVKNFQRLTHF---L*YWRYKCSRHFFCHRIFSDITEWLQY 277 V L+ HN++Y K+++ HF L +C RH + H + +D T W Y Sbjct: 299 VMLLGHNDSYTRDKMMQVTVAYNHFGEGLIQRMPRC-RHGYFHVVNNDYTHWKMY 352 >At3g48460.1 68416.m05290 GDSL-motif lipase/hydrolase family protein similar to lipase [Arabidopsis thaliana] GI:1145627; contains InterPro Entry IPR001087 Lipolytic enzyme, G-D-S-L family Length = 381 Score = 27.5 bits (58), Expect = 6.0 Identities = 10/36 (27%), Positives = 17/36 (47%) Frame = -3 Query: 167 QVLETYNFHCEKLMQPTNXHIEWDHTHINRCLLKIM 60 QV +T + + N +I WD H+ + K+M Sbjct: 321 QVFQTCGTDAATVCKDPNQYINWDGVHLTEAMYKVM 356 >At4g24880.1 68417.m03560 expressed protein Length = 417 Score = 27.1 bits (57), Expect = 7.9 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +3 Query: 231 FSVTEYFQTLQSGFSIEGSYTISAPSITSGLLF 329 FSV ++ QSG + +YT S P + GLLF Sbjct: 230 FSVVPFYNCDQSG--LHSAYTGSLPYVRDGLLF 260 >At3g24670.1 68416.m03097 pectate lyase family protein similar to pectate lyase GP:14531296 from [Fragaria x ananassa] Length = 440 Score = 27.1 bits (57), Expect = 7.9 Identities = 17/55 (30%), Positives = 28/55 (50%), Gaps = 3/55 (5%) Frame = +2 Query: 122 VALIFHNENYRFPKLVKNFQRLTHF---L*YWRYKCSRHFFCHRIFSDITEWLQY 277 V L+ H+++Y KL++ HF L +C RH + H + +D T W+ Y Sbjct: 287 VMLMGHSDSYTRDKLMQVTIAYNHFGEGLIQRMPRC-RHGYFHVVNNDYTHWVMY 340 >At1g27660.1 68414.m03381 ethylene-responsive protein -related contains similarity to ethylene-inducible ER33 protein [Lycopersicon esculentum] gi|5669656|gb|AAD46413 Length = 453 Score = 27.1 bits (57), Expect = 7.9 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +3 Query: 213 INVHVIFSVTEYFQTLQSGFSIEGSYTISAPSITS 317 IN H ++ +++ SGF I G Y S PS +S Sbjct: 150 INEHKDYTEKLLLKSMSSGFPINGDYGSSLPSSSS 184 >At1g19980.1 68414.m02503 cytomatrix protein-related contains weak similarity to CAST1 [Rattus norvegicus] gi|22138113|gb|AAL07517 Length = 342 Score = 27.1 bits (57), Expect = 7.9 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +3 Query: 444 ICCAIKNRFSSVINIKLETEYQELVNFK 527 + C +K + S+ N+KLE EL +FK Sbjct: 89 LLCGLKEKDRSLCNLKLEHSLDELKDFK 116 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,412,408 Number of Sequences: 28952 Number of extensions: 203301 Number of successful extensions: 496 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 487 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 496 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 993966856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -