BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0933 (598 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC216.06c |swi1||replication fork protection complex subunit S... 29 0.68 SPAC26A3.11 |||amidohydrolase|Schizosaccharomyces pombe|chr 1|||... 27 1.6 SPAP27G11.10c |nup184||nucleoporin Nup184|Schizosaccharomyces po... 27 2.7 SPAC3A12.05c |taf2||TATA-binding protein associated factor Taf2|... 25 8.4 >SPBC216.06c |swi1||replication fork protection complex subunit Swi1|Schizosaccharomyces pombe|chr 2|||Manual Length = 971 Score = 28.7 bits (61), Expect = 0.68 Identities = 13/38 (34%), Positives = 25/38 (65%) Frame = +1 Query: 313 KITVKKRLLVFYFIIDLSWMLNKNVFKH*FFSSTNASR 426 +I VK++ V+ + +D +L+K H +FS+TN++R Sbjct: 598 RIFVKQKCHVYLYRLDFLRVLDKMFNDHVYFSTTNSAR 635 >SPAC26A3.11 |||amidohydrolase|Schizosaccharomyces pombe|chr 1|||Manual Length = 322 Score = 27.5 bits (58), Expect = 1.6 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = -3 Query: 176 AEDRNTDYLHKWIIKTV*DLYGRVLA 99 A D N DY H W TV D +G+V+A Sbjct: 251 ARDMNADY-HSWGHSTVVDPFGKVIA 275 >SPAP27G11.10c |nup184||nucleoporin Nup184|Schizosaccharomyces pombe|chr 1|||Manual Length = 1564 Score = 26.6 bits (56), Expect = 2.7 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = +3 Query: 204 IYRRFALKGLKTMLLN*AANVEFVNPMTLVTKK 302 I RFA L T LLN +E+ NP T V KK Sbjct: 761 IGHRFA--SLITKLLNVTFGIEYFNPKTTVNKK 791 >SPAC3A12.05c |taf2||TATA-binding protein associated factor Taf2|Schizosaccharomyces pombe|chr 1|||Manual Length = 1174 Score = 25.0 bits (52), Expect = 8.4 Identities = 18/59 (30%), Positives = 26/59 (44%) Frame = +3 Query: 63 CILTYQKLYTCAR*NTSVQVLYCFYNPFV*IVGIPIFRTV*RTNRASIYRRFALKGLKT 239 C+ T L TC + S L F ++ G PIFR V R NR + + ++T Sbjct: 512 CLSTSHFLKTCEK--ASHMRLDVFAQQWIYGYGYPIFRVVQRFNRKKMIIEMGIDQVQT 568 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,068,263 Number of Sequences: 5004 Number of extensions: 36472 Number of successful extensions: 67 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 66 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 67 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 260219058 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -