BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0930 (668 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory recept... 24 1.3 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 22 5.2 AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory recept... 21 6.9 AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. 21 6.9 >AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory receptor candidate 48 protein. Length = 408 Score = 23.8 bits (49), Expect = 1.3 Identities = 11/33 (33%), Positives = 15/33 (45%) Frame = -3 Query: 600 SCMATPSTDIVISTFLHFAPIFRFGLLXLLWNC 502 SC +T +I L + I L +LWNC Sbjct: 259 SCTSTNCPRFLIMLALSYTVIQEVMLFTILWNC 291 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 21.8 bits (44), Expect = 5.2 Identities = 13/41 (31%), Positives = 16/41 (39%) Frame = -2 Query: 586 TVHRYRYFDFLAFRAHLSLRTSXVAVEL*FLDCIFDHLDAF 464 TVH Y F+ F H L T L C++ AF Sbjct: 80 TVHLLFYCPFIIFTVHFLLCTYYFYYAFIILLCVYYFYYAF 120 >AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory receptor candidate 41 protein. Length = 398 Score = 21.4 bits (43), Expect = 6.9 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +2 Query: 269 IEYGANGSKSGKTNSRMSTLLFWQGKGKGN 358 I+YG S G T + LL +Q +GK N Sbjct: 369 IDYGTLYSLFGSTAMNVIILLQFQKQGKYN 398 >AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. Length = 256 Score = 21.4 bits (43), Expect = 6.9 Identities = 7/16 (43%), Positives = 8/16 (50%) Frame = +2 Query: 335 WQGKGKGNGAPNGRNW 382 WQ G+ G RNW Sbjct: 116 WQDSGESPGFTTERNW 131 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 141,645 Number of Sequences: 336 Number of extensions: 2793 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17385535 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -