BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0929 (598 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g78900.1 68414.m09198 vacuolar ATP synthase catalytic subunit... 119 2e-27 At5g08690.1 68418.m01034 ATP synthase beta chain 2, mitochondria... 40 0.002 At5g08680.1 68418.m01033 ATP synthase beta chain, mitochondrial,... 40 0.002 At5g08670.1 68418.m01032 ATP synthase beta chain 1, mitochondria... 40 0.002 At5g38340.1 68418.m04627 disease resistance protein (TIR-NBS-LRR... 30 1.3 At4g39850.1 68417.m05646 peroxisomal ABC transporter (PXA1) iden... 28 4.1 At1g17970.1 68414.m02223 zinc finger (C3HC4-type RING finger) fa... 28 4.1 At4g38510.2 68417.m05447 vacuolar ATP synthase subunit B, putati... 28 5.4 At4g38510.1 68417.m05446 vacuolar ATP synthase subunit B, putati... 28 5.4 At1g76030.1 68414.m08827 vacuolar ATP synthase subunit B / V-ATP... 28 5.4 At1g20260.2 68414.m02530 vacuolar ATP synthase subunit B, putati... 28 5.4 At1g20260.1 68414.m02529 vacuolar ATP synthase subunit B, putati... 28 5.4 At5g62760.2 68418.m07879 nuclear protein ZAP-related similar to ... 27 7.2 At5g62760.1 68418.m07878 nuclear protein ZAP-related similar to ... 27 7.2 At3g26030.1 68416.m03242 serine/threonine protein phosphatase 2A... 27 7.2 At3g01040.1 68416.m00005 glycosyl transferase family 8 protein c... 27 7.2 At4g12490.1 68417.m01974 protease inhibitor/seed storage/lipid t... 27 9.5 >At1g78900.1 68414.m09198 vacuolar ATP synthase catalytic subunit A / V-ATPase A subunit / vacuolar proton pump alpha subunit / V-ATPase 69 kDa subunit identical to SP|O23654 Vacuolar ATP synthase catalytic subunit A (EC 3.6.3.14) (V-ATPase A subunit) (Vacuolar proton pump alpha subunit) (V-ATPase 69 kDa subunit) {Arabidopsis thaliana} Length = 623 Score = 119 bits (286), Expect = 2e-27 Identities = 56/96 (58%), Positives = 72/96 (75%), Gaps = 1/96 (1%) Frame = +1 Query: 256 QVYEETSGVTVGDPVLRTGKPLSVELGPGILGSIFDGIQRPLKDINELTQSIYIPKGINV 435 QVYEET+G+TV DPVLRT KPLSVELGPGILG+IFDGIQRPLK I ++ +YIP+G++V Sbjct: 68 QVYEETAGLTVNDPVLRTHKPLSVELGPGILGNIFDGIQRPLKTIARISGDVYIPRGVSV 127 Query: 436 PSLAREVDWEFNPLNVKVGSHIT-GEICMVLYTRTL 540 P+L ++ WEF P G IT G++ ++ TL Sbjct: 128 PALDKDCLWEFQPNKFVEGDTITGGDLYATVFENTL 163 Score = 81.8 bits (193), Expect = 3e-16 Identities = 38/60 (63%), Positives = 47/60 (78%) Frame = +2 Query: 74 GGLRTIANEENEERFGYVFAVSGPVVTAEKMSGSAMYELVRVGYNELVGEIIRLEGDMAT 253 G L T ++E E +GYV VSGPVV A+ M+G+AMYELVRVG++ L+GEIIRLEGD AT Sbjct: 7 GKLTTFEDDEKESEYGYVRKVSGPVVVADGMAGAAMYELVRVGHDNLIGEIIRLEGDSAT 66 Score = 39.1 bits (87), Expect = 0.002 Identities = 16/29 (55%), Positives = 20/29 (68%) Frame = +3 Query: 510 DLYGIVHENTLVKHRMLVPPKAKGTVTYI 596 DLY V ENTL+ H + +PP A G +TYI Sbjct: 153 DLYATVFENTLMNHLVALPPDAMGKITYI 181 >At5g08690.1 68418.m01034 ATP synthase beta chain 2, mitochondrial identical to SP|P83484 ATP synthase beta chain 2, mitochondrial precursor (EC 3.6.3.14) {Arabidopsis thaliana}; strong similarity to SP|P17614 ATP synthase beta chain, mitochondrial precursor (EC 3.6.3.14) {Nicotiana plumbaginifolia}; contains Pfam profiles PF00006: ATP synthase alpha/beta family nucleotide-binding domain, PF00306: ATP synthase ab C terminal, PF02874: ATP synthase alpha/beta family beta-barrel domain; supporting cDNA gi|26452187|dbj|AK118582.1| Length = 556 Score = 39.5 bits (88), Expect = 0.002 Identities = 19/58 (32%), Positives = 31/58 (53%) Frame = +1 Query: 271 TSGVTVGDPVLRTGKPLSVELGPGILGSIFDGIQRPLKDINELTQSIYIPKGINVPSL 444 T G+ G VL TG P++V +G LG I + + P+ + E+ Y+P + P+L Sbjct: 141 TEGLVRGRKVLNTGAPITVPVGRATLGRIMNVLGEPIDERGEIKTEHYLPIHRDAPAL 198 >At5g08680.1 68418.m01033 ATP synthase beta chain, mitochondrial, putative strong similarity to SP|P83483 ATP synthase beta chain 1, mitochondrial precursor (EC 3.6.3.14) {Arabidopsis thaliana}, SP|P17614 ATP synthase beta chain, mitochondrial precursor (EC 3.6.3.14) {Nicotiana plumbaginifolia}; contains Pfam profiles PF00006: ATP synthase alpha/beta family nucleotide-binding domain, PF00306: ATP synthase ab C terminal, PF02874: ATP synthase alpha/beta family beta-barrel domain Length = 559 Score = 39.5 bits (88), Expect = 0.002 Identities = 19/58 (32%), Positives = 31/58 (53%) Frame = +1 Query: 271 TSGVTVGDPVLRTGKPLSVELGPGILGSIFDGIQRPLKDINELTQSIYIPKGINVPSL 444 T G+ G VL TG P++V +G LG I + + P+ + E+ Y+P + P+L Sbjct: 144 TEGLVRGRKVLNTGAPITVPVGRATLGRIMNVLGEPIDERGEIKTEHYLPIHRDAPAL 201 >At5g08670.1 68418.m01032 ATP synthase beta chain 1, mitochondrial identical to SP|P83483 ATP synthase beta chain 1, mitochondrial precursor (EC 3.6.3.14) {Arabidopsis thaliana}; strong similarity to SP|P17614 ATP synthase beta chain, mitochondrial precursor (EC 3.6.3.14) {Nicotiana plumbaginifolia}; contains Pfam profiles PF00006: ATP synthase alpha/beta family nucleotide-binding domain, PF00306: ATP synthase ab C terminal, PF02874: ATP synthase alpha/beta family beta-barrel domain; supporting cDNA gi|26452102|dbj|AK118538.1| Length = 556 Score = 39.5 bits (88), Expect = 0.002 Identities = 19/58 (32%), Positives = 31/58 (53%) Frame = +1 Query: 271 TSGVTVGDPVLRTGKPLSVELGPGILGSIFDGIQRPLKDINELTQSIYIPKGINVPSL 444 T G+ G VL TG P++V +G LG I + + P+ + E+ Y+P + P+L Sbjct: 141 TEGLVRGRKVLNTGAPITVPVGRATLGRIMNVLGEPIDERGEIKTEHYLPIHRDAPAL 198 >At5g38340.1 68418.m04627 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1059 Score = 29.9 bits (64), Expect = 1.3 Identities = 9/34 (26%), Positives = 24/34 (70%), Gaps = 1/34 (2%) Frame = +1 Query: 379 LKDINELTQSIYIPKGIN-VPSLAREVDWEFNPL 477 L+ + + ++ +Y+P+G+N +P R ++W++ P+ Sbjct: 613 LRVLRDRSEKLYLPQGLNYLPKKLRLIEWDYFPM 646 >At4g39850.1 68417.m05646 peroxisomal ABC transporter (PXA1) identical to peroxisomal ABC transporter PXA1 GI:15320529 from [Arabidopsis thaliana]; contains Pfam profile PF00005: ABC transporter; Length = 1337 Score = 28.3 bits (60), Expect = 4.1 Identities = 16/44 (36%), Positives = 22/44 (50%) Frame = -1 Query: 346 RYRDQVLLTKAFQYGVLDHLQLHLKFLRIPGGGHVTFKTDNLTD 215 RY V+ +G D L+LH KFL + GG + F+ D D Sbjct: 1035 RYLASVVSQSFMAFG--DILELHKKFLELSGGINRIFELDEFLD 1076 >At1g17970.1 68414.m02223 zinc finger (C3HC4-type RING finger) family protein similar to Pfam domain, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 368 Score = 28.3 bits (60), Expect = 4.1 Identities = 12/33 (36%), Positives = 21/33 (63%) Frame = +1 Query: 403 QSIYIPKGINVPSLAREVDWEFNPLNVKVGSHI 501 +S+ P+G N+PS R++D + N N +GS + Sbjct: 163 RSVDPPRGRNIPSSRRKIDVDNNNYNHTLGSSV 195 >At4g38510.2 68417.m05447 vacuolar ATP synthase subunit B, putative / V-ATPase B subunit, putative / vacuolar proton pump B subunit, putative / V-ATPase 57 kDa subunit, putative very strong similarity to SP|P11574 Vacuolar ATP synthase subunit B (EC 3.6.3.14) (V-ATPase B subunit) (Vacuolar proton pump B subunit) (V-ATPase 57 kDa subunit) {Arabidopsis thaliana}; contains Pfam profiles PF00006: ATP synthase alpha/beta family nucleotide-binding domain, PF00306: ATP synthase ab C terminal, PF02874: ATP synthase alpha/beta family beta-barrel domain Length = 487 Score = 27.9 bits (59), Expect = 5.4 Identities = 16/55 (29%), Positives = 29/55 (52%), Gaps = 1/55 (1%) Frame = +1 Query: 256 QVYEETSGVTVGDPVLR-TGKPLSVELGPGILGSIFDGIQRPLKDINELTQSIYI 417 QV+E TSG+ ++ TG+ L + +LG IF+G +P+ + + Y+ Sbjct: 70 QVFEGTSGIDNKYTTVQFTGEVLKTPVSLDMLGRIFNGSGKPIDNGPPILPEAYL 124 >At4g38510.1 68417.m05446 vacuolar ATP synthase subunit B, putative / V-ATPase B subunit, putative / vacuolar proton pump B subunit, putative / V-ATPase 57 kDa subunit, putative very strong similarity to SP|P11574 Vacuolar ATP synthase subunit B (EC 3.6.3.14) (V-ATPase B subunit) (Vacuolar proton pump B subunit) (V-ATPase 57 kDa subunit) {Arabidopsis thaliana}; contains Pfam profiles PF00006: ATP synthase alpha/beta family nucleotide-binding domain, PF00306: ATP synthase ab C terminal, PF02874: ATP synthase alpha/beta family beta-barrel domain Length = 487 Score = 27.9 bits (59), Expect = 5.4 Identities = 16/55 (29%), Positives = 29/55 (52%), Gaps = 1/55 (1%) Frame = +1 Query: 256 QVYEETSGVTVGDPVLR-TGKPLSVELGPGILGSIFDGIQRPLKDINELTQSIYI 417 QV+E TSG+ ++ TG+ L + +LG IF+G +P+ + + Y+ Sbjct: 70 QVFEGTSGIDNKYTTVQFTGEVLKTPVSLDMLGRIFNGSGKPIDNGPPILPEAYL 124 >At1g76030.1 68414.m08827 vacuolar ATP synthase subunit B / V-ATPase B subunit / vacuolar proton pump B subunit / V-ATPase 57 kDa subunit identical to SP|P11574 Vacuolar ATP synthase subunit B (EC 3.6.3.14) (V-ATPase B subunit) (Vacuolar proton pump B subunit) (V-ATPase 57 kDa subunit) {Arabidopsis thaliana} Length = 486 Score = 27.9 bits (59), Expect = 5.4 Identities = 16/55 (29%), Positives = 29/55 (52%), Gaps = 1/55 (1%) Frame = +1 Query: 256 QVYEETSGVTVGDPVLR-TGKPLSVELGPGILGSIFDGIQRPLKDINELTQSIYI 417 QV+E TSG+ ++ TG+ L + +LG IF+G +P+ + + Y+ Sbjct: 69 QVFEGTSGIDNKFTTVQFTGEVLKTPVSLDMLGRIFNGSGKPIDNGPPILPEAYL 123 >At1g20260.2 68414.m02530 vacuolar ATP synthase subunit B, putative / V-ATPase B subunit, putative / vacuolar proton pump B subunit, putative / V-ATPase 57 kDa subunit, putative strong similarity to SP|P11574 Vacuolar ATP synthase subunit B (EC 3.6.3.14) (V-ATPase B subunit) (Vacuolar proton pump B subunit) (V-ATPase 57 kDa subunit) {Arabidopsis thaliana}; contains Pfam profiles PF00006: ATP synthase alpha/beta family nucleotide-binding domain, PF02874: ATP synthase alpha/beta family beta-barrel domain Length = 485 Score = 27.9 bits (59), Expect = 5.4 Identities = 16/55 (29%), Positives = 29/55 (52%), Gaps = 1/55 (1%) Frame = +1 Query: 256 QVYEETSGVTVGDPVLR-TGKPLSVELGPGILGSIFDGIQRPLKDINELTQSIYI 417 QV+E TSG+ ++ TG+ L + +LG IF+G +P+ + + Y+ Sbjct: 69 QVFEGTSGIDNKFTTVQFTGEVLKTPVSLDMLGRIFNGSGKPIDNGPPILPEAYL 123 >At1g20260.1 68414.m02529 vacuolar ATP synthase subunit B, putative / V-ATPase B subunit, putative / vacuolar proton pump B subunit, putative / V-ATPase 57 kDa subunit, putative strong similarity to SP|P11574 Vacuolar ATP synthase subunit B (EC 3.6.3.14) (V-ATPase B subunit) (Vacuolar proton pump B subunit) (V-ATPase 57 kDa subunit) {Arabidopsis thaliana}; contains Pfam profiles PF00006: ATP synthase alpha/beta family nucleotide-binding domain, PF02874: ATP synthase alpha/beta family beta-barrel domain Length = 330 Score = 27.9 bits (59), Expect = 5.4 Identities = 16/55 (29%), Positives = 29/55 (52%), Gaps = 1/55 (1%) Frame = +1 Query: 256 QVYEETSGVTVGDPVLR-TGKPLSVELGPGILGSIFDGIQRPLKDINELTQSIYI 417 QV+E TSG+ ++ TG+ L + +LG IF+G +P+ + + Y+ Sbjct: 69 QVFEGTSGIDNKFTTVQFTGEVLKTPVSLDMLGRIFNGSGKPIDNGPPILPEAYL 123 >At5g62760.2 68418.m07879 nuclear protein ZAP-related similar to nuclear protein ZAP, Mus musculus, EMBL:AB033168 this cDNA provides a truncated ORF likely due to a skipped exon. An alternative ORF is provided. Length = 383 Score = 27.5 bits (58), Expect = 7.2 Identities = 16/36 (44%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Frame = -3 Query: 365 PSKMEPKIPGPSSTDKG-FPVRSTGSPTVTPEVSSY 261 P + P P PSS FPV + SPT+ P SSY Sbjct: 204 PLPVSPPPPLPSSHPSSLFPVTTNSSPTIPPS-SSY 238 >At5g62760.1 68418.m07878 nuclear protein ZAP-related similar to nuclear protein ZAP, Mus musculus, EMBL:AB033168 this cDNA provides a truncated ORF likely due to a skipped exon. An alternative ORF is provided. Length = 661 Score = 27.5 bits (58), Expect = 7.2 Identities = 16/36 (44%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Frame = -3 Query: 365 PSKMEPKIPGPSSTDKG-FPVRSTGSPTVTPEVSSY 261 P + P P PSS FPV + SPT+ P SSY Sbjct: 204 PLPVSPPPPLPSSHPSSLFPVTTNSSPTIPPS-SSY 238 >At3g26030.1 68416.m03242 serine/threonine protein phosphatase 2A (PP2A) regulatory subunit B', putative similar to SWISS-PROT:Q28653 serine/threonine protein phosphatase 2A, 56 kDa regulatory subunit, delta isoform (PP2A, B subunit, B' delta isoform, PP2A, B subunit, B56 delta isoform, PP2A, B subunit, PR61 delta isoform, PP2A, B subunit, R5 delta isoform, PP2A, B subunit, B'-gamma) [Oryctolagus cuniculus]; contains Pfam domain, PF01603: Protein phosphatase 2A regulatory B subunit (B56 family) Length = 477 Score = 27.5 bits (58), Expect = 7.2 Identities = 15/50 (30%), Positives = 24/50 (48%) Frame = +1 Query: 250 HHQVYEETSGVTVGDPVLRTGKPLSVELGPGILGSIFDGIQRPLKDINEL 399 H +T + D + TGK + +LGSI +G PLK+ ++L Sbjct: 231 HRPFIRKTMNNILYDFIFETGKHSGIAEFLEVLGSIINGFALPLKEEHKL 280 >At3g01040.1 68416.m00005 glycosyl transferase family 8 protein contains Pfam profile: PF01501 glycosyl transferase family 8 Length = 533 Score = 27.5 bits (58), Expect = 7.2 Identities = 14/39 (35%), Positives = 22/39 (56%), Gaps = 3/39 (7%) Frame = +1 Query: 331 LGPGILGSIFDGIQRPLKDINELTQSI---YIPKGINVP 438 LGP +LG I D QR ++D ++ + IP G+ +P Sbjct: 77 LGPRLLGRIDDSEQRLVRDFYKILNEVSTQEIPDGLKLP 115 >At4g12490.1 68417.m01974 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to pEARLI 1 (Accession No. L43080): an Arabidopsis member of a conserved gene family (PGF95-099), Plant Physiol. 109 (4), 1497 (1995); contains Pfam protease inhibitor/seed storage/LTP family domain PF00234 Length = 182 Score = 27.1 bits (57), Expect = 9.5 Identities = 15/35 (42%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = -3 Query: 365 PSKMEPKIPGPSSTDKGFPVRSTGSPTV-TPEVSS 264 P PK+P PS P S SP+V TP V S Sbjct: 42 PKVPSPKVPTPSVPSPYVPTPSVPSPSVPTPSVPS 76 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,134,027 Number of Sequences: 28952 Number of extensions: 304655 Number of successful extensions: 912 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 886 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 910 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1190791976 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -