BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0928 (698 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. 124 8e-31 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 111 8e-27 AB095513-1|BAC76335.1| 39|Apis mellifera brood-complex protein. 38 7e-05 DQ435333-1|ABD92648.1| 135|Apis mellifera OBP16 protein. 26 0.30 AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 24 1.6 DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like recept... 23 3.7 DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protei... 22 6.4 DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related pro... 22 6.4 >AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. Length = 429 Score = 124 bits (299), Expect = 8e-31 Identities = 60/138 (43%), Positives = 88/138 (63%), Gaps = 1/138 (0%) Frame = +1 Query: 124 MASDEQFSLCWNNFHANMSAGFHGLLSRGDLVDVTLAAEGX-IARHKLVLSVCSPYFQEM 300 M + F L WNN+ +++++ F L D VDVTLA +G + H++VLS CSPYF+E+ Sbjct: 1 MVDTQHFCLRWNNYQSSITSAFENLRDDEDFVDVTLACDGRSLKAHRVVLSACSPYFREL 60 Query: 301 FKMNPTQHPIVFLKDVSHSALRDLLQFMYQGEVNVKQEELASFISTAEQLQVKGLTGNQN 480 K P +HP++ L+DV+ S L L++F+Y GEVNV Q L+SF+ TAE L+V GLT Q Sbjct: 61 LKSTPCKHPVIVLQDVAFSDLHALVEFIYHGEVNVHQRSLSSFLKTAEVLRVSGLT--QQ 118 Query: 481 EESSTPSKPSRLRGQAPG 534 + + + S +R A G Sbjct: 119 ADQTDRDELSHVRALAAG 136 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 111 bits (266), Expect = 8e-27 Identities = 54/135 (40%), Positives = 82/135 (60%), Gaps = 2/135 (1%) Frame = +1 Query: 136 EQFSLCWNNFHANMSAGFHGLLSRGDLVDVTLAA-EGXIARHKLVLSVCSPYFQEMFKMN 312 + + L WNN+ +NM++ FH LL VDVTLA E + HK+VLS CS YFQ++ N Sbjct: 9 QHYCLRWNNYQSNMTSVFHQLLQTEAFVDVTLACNEASLKAHKVVLSACSSYFQKLLLSN 68 Query: 313 PTQHPIVFL-KDVSHSALRDLLQFMYQGEVNVKQEELASFISTAEQLQVKGLTGNQNEES 489 P +HP + + +DV + L+ +++F+Y+GE++V Q EL S + TA+QL++KGL Sbjct: 69 PCKHPTIIMPQDVCFNDLKFIIEFVYRGEIDVSQAELQSLLKTADQLKIKGLCEVPESRD 128 Query: 490 STPSKPSRLRGQAPG 534 PS + PG Sbjct: 129 GPPSVSLSSPPREPG 143 >AB095513-1|BAC76335.1| 39|Apis mellifera brood-complex protein. Length = 39 Score = 38.3 bits (85), Expect = 7e-05 Identities = 16/39 (41%), Positives = 23/39 (58%) Frame = +1 Query: 124 MASDEQFSLCWNNFHANMSAGFHGLLSRGDLVDVTLAAE 240 M + F L WNN+ +++++ F L D VDVTLA E Sbjct: 1 MVDTQHFCLRWNNYQSSITSAFENLRDDEDFVDVTLACE 39 >DQ435333-1|ABD92648.1| 135|Apis mellifera OBP16 protein. Length = 135 Score = 26.2 bits (55), Expect = 0.30 Identities = 12/42 (28%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Frame = +1 Query: 370 LLQFMYQGEVNVKQEELASFIS-TAEQLQVKGLTGNQNEESS 492 ++ +Y G VNV+ E + S++ ++ V GN NE+++ Sbjct: 43 IIDEVYNGNVNVEDENVQSYVECMMKKFNVVDENGNFNEKNT 84 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 23.8 bits (49), Expect = 1.6 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = -1 Query: 488 LSSF*LPVKPLT*SCSAVLINDANSSCLTLTSP 390 LSS P+T + S ++ N NS+C SP Sbjct: 323 LSSSTTTTSPMTSTKSTIVRNHLNSTCSVTNSP 355 >DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like receptor 2 protein. Length = 581 Score = 22.6 bits (46), Expect = 3.7 Identities = 13/44 (29%), Positives = 21/44 (47%) Frame = +1 Query: 100 VPRRVVAIMASDEQFSLCWNNFHANMSAGFHGLLSRGDLVDVTL 231 V R +VA++ + F +CW FHA + S+ DV + Sbjct: 283 VIRMLVAVVVA---FFICWAPFHAQRLLAVYAQNSKDKPEDVLI 323 >DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protein protein. Length = 424 Score = 21.8 bits (44), Expect = 6.4 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +2 Query: 101 FHVESSLSWRRTNNFHY 151 + +S SWR TNN Y Sbjct: 211 YDFRNSRSWRITNNLFY 227 >DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related protein STG-1 protein. Length = 397 Score = 21.8 bits (44), Expect = 6.4 Identities = 8/11 (72%), Positives = 9/11 (81%), Gaps = 1/11 (9%) Frame = -2 Query: 550 CLCCDDL-GPG 521 C CCD+L GPG Sbjct: 13 CWCCDNLGGPG 23 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 185,317 Number of Sequences: 438 Number of extensions: 3401 Number of successful extensions: 16 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21439440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -