BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0924 (648 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 23 2.5 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 23 2.5 DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. 22 5.9 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 22 5.9 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 23.0 bits (47), Expect = 2.5 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = +2 Query: 389 ECLNPWRDDTEEEELA 436 + L W DD++EEEL+ Sbjct: 34 QMLGIWADDSDEEELS 49 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 23.0 bits (47), Expect = 2.5 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = -2 Query: 308 IRVHVLHCKTWPQCRQTPLKSSQGADSPTNIRG*GCH 198 ++ HVL T P+ + TP ++ NIR CH Sbjct: 391 VQTHVLTIHTIPEVKVTPRFQAKRLKEEANIR---CH 424 >DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. Length = 471 Score = 21.8 bits (44), Expect = 5.9 Identities = 7/22 (31%), Positives = 12/22 (54%) Frame = -3 Query: 421 FSVITPWVETFIIIRFICAIHN 356 + ITP ++ + I C +HN Sbjct: 312 YKYITPLIQKHLKIHDTCGVHN 333 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 21.8 bits (44), Expect = 5.9 Identities = 10/33 (30%), Positives = 14/33 (42%) Frame = +2 Query: 371 YEPNDDECLNPWRDDTEEEELARAVQNAAITEG 469 ++P D+EC E R N+ IT G Sbjct: 199 WQPEDEECTEATAGAVVLETCQRNSNNSTITAG 231 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 162,990 Number of Sequences: 438 Number of extensions: 2914 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19560480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -