BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0921 (668 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_33675| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.64 SB_43292| Best HMM Match : FYRN (HMM E-Value=6.3e-15) 31 1.1 SB_35214| Best HMM Match : FYRN (HMM E-Value=6.3e-15) 31 1.1 SB_48580| Best HMM Match : FYRN (HMM E-Value=6.3e-15) 31 1.1 SB_5164| Best HMM Match : FYRN (HMM E-Value=6.3e-15) 31 1.1 SB_59316| Best HMM Match : LRR_1 (HMM E-Value=0) 30 2.0 SB_27310| Best HMM Match : CUB (HMM E-Value=9.7e-17) 30 2.0 SB_50787| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_21831| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_23154| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_23772| Best HMM Match : Remorin_C (HMM E-Value=1.9) 29 2.6 SB_52694| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_41567| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_19215| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_33233| Best HMM Match : Vicilin_N (HMM E-Value=1) 29 3.4 SB_3122| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_58470| Best HMM Match : VPS9 (HMM E-Value=0.0012) 29 4.5 SB_38361| Best HMM Match : VPS9 (HMM E-Value=0.0012) 29 4.5 SB_40415| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_37356| Best HMM Match : Integrin_alpha (HMM E-Value=0.24) 28 7.9 SB_9234| Best HMM Match : Topoisom_I_N (HMM E-Value=0) 28 7.9 >SB_33675| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 31.5 bits (68), Expect = 0.64 Identities = 21/85 (24%), Positives = 40/85 (47%), Gaps = 4/85 (4%) Frame = +3 Query: 249 DPEFNDDYHEAEESIEPTNHEISKNTRQATLEIYL----QKIKKSNMEKNMRIEQEVRNS 416 DPE+N+DY +PT + KN+R+ L I+ Q+ + + + ++ VR Sbjct: 19 DPEYNEDYD------KPTTTKTGKNSRRFCLSIFFYFQGQEALSGEEKCDRKAKRIVRTH 72 Query: 417 LKAMKQCKQNVNIFKVPAKPLFARH 491 +K + V ++ + P+F H Sbjct: 73 MKVAQTVLVLVGVYIITWIPVFVLH 97 >SB_43292| Best HMM Match : FYRN (HMM E-Value=6.3e-15) Length = 645 Score = 30.7 bits (66), Expect = 1.1 Identities = 22/67 (32%), Positives = 32/67 (47%), Gaps = 1/67 (1%) Frame = -1 Query: 212 LASTSAVCLLADFSITNARKDFRGVKSLPNVCRSVFLVVL*ESHPDPSALEFLVPS-VIL 36 L ST +++TN+ K LPN+ ++V L +H P+ L L PS Sbjct: 328 LPSTPPSPFYKSYALTNSSPLSSPRKILPNIQQTVRFPALYNTHTGPNNLSSLTPSKAPQ 387 Query: 35 VLSTGGN 15 VLS GG+ Sbjct: 388 VLSKGGS 394 >SB_35214| Best HMM Match : FYRN (HMM E-Value=6.3e-15) Length = 762 Score = 30.7 bits (66), Expect = 1.1 Identities = 22/67 (32%), Positives = 32/67 (47%), Gaps = 1/67 (1%) Frame = -1 Query: 212 LASTSAVCLLADFSITNARKDFRGVKSLPNVCRSVFLVVL*ESHPDPSALEFLVPS-VIL 36 L ST +++TN+ K LPN+ ++V L +H P+ L L PS Sbjct: 180 LPSTPPSPFYKSYALTNSSPLSSPRKILPNIQQTVRFPALYNTHTGPNNLSSLTPSKAPQ 239 Query: 35 VLSTGGN 15 VLS GG+ Sbjct: 240 VLSKGGS 246 >SB_48580| Best HMM Match : FYRN (HMM E-Value=6.3e-15) Length = 847 Score = 30.7 bits (66), Expect = 1.1 Identities = 22/67 (32%), Positives = 32/67 (47%), Gaps = 1/67 (1%) Frame = -1 Query: 212 LASTSAVCLLADFSITNARKDFRGVKSLPNVCRSVFLVVL*ESHPDPSALEFLVPS-VIL 36 L ST +++TN+ K LPN+ ++V L +H P+ L L PS Sbjct: 328 LPSTPPSPFYKSYALTNSSPLSSPRKILPNIQQTVRFPALYNTHTGPNNLSSLTPSKAPQ 387 Query: 35 VLSTGGN 15 VLS GG+ Sbjct: 388 VLSKGGS 394 >SB_5164| Best HMM Match : FYRN (HMM E-Value=6.3e-15) Length = 435 Score = 30.7 bits (66), Expect = 1.1 Identities = 22/67 (32%), Positives = 32/67 (47%), Gaps = 1/67 (1%) Frame = -1 Query: 212 LASTSAVCLLADFSITNARKDFRGVKSLPNVCRSVFLVVL*ESHPDPSALEFLVPS-VIL 36 L ST +++TN+ K LPN+ ++V L +H P+ L L PS Sbjct: 328 LPSTPPSPFYKSYALTNSSPLSSPRKILPNIQQTVRFPALYNTHTGPNNLSSLTPSKAPQ 387 Query: 35 VLSTGGN 15 VLS GG+ Sbjct: 388 VLSKGGS 394 >SB_59316| Best HMM Match : LRR_1 (HMM E-Value=0) Length = 680 Score = 29.9 bits (64), Expect = 2.0 Identities = 25/97 (25%), Positives = 41/97 (42%), Gaps = 6/97 (6%) Frame = +3 Query: 156 TSVSNGKVR*ETDCTC*CQRNF*NATSKFYRDPEFNDDYHEAEESIEPTNH--EISKNTR 329 T S G+ +TD + + ++ ++T Y D + +A E E TNH +I+ + Sbjct: 530 TVYSPGEREADTDSSHAIEESYLSSTHFNYTPNYITDIFEDASEGKESTNHTDDIAASGE 589 Query: 330 QATLEIYLQKIKKSNME----KNMRIEQEVRNSLKAM 428 LEI I N ++ VRN LK + Sbjct: 590 DWDLEIEASYISNPNAHAPAPPTKMVDMSVRNQLKCL 626 >SB_27310| Best HMM Match : CUB (HMM E-Value=9.7e-17) Length = 761 Score = 29.9 bits (64), Expect = 2.0 Identities = 19/58 (32%), Positives = 31/58 (53%), Gaps = 2/58 (3%) Frame = -1 Query: 404 FLFYSHVFLHV--AFLYFLQIYF*GCLTSIFRYFMICWFD*FLCFMVVIIKFGISVEF 237 F+ Y + FL V AF+ F+ I+F + +F F + F F F+ ++ F +SV F Sbjct: 687 FVVYPYFFLFVVFAFVVFIFIFFFAFVIFVFNAFFV--FVVFAFFVFLVFVFFVSVVF 742 >SB_50787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 599 Score = 29.9 bits (64), Expect = 2.0 Identities = 16/57 (28%), Positives = 30/57 (52%) Frame = +1 Query: 157 RALVMEKSAKRQTALVDAKEISKMPQANSTEIPNLMMTTMKQRNQSNQQIMKYLKIL 327 R + + KR+ +DA+E S+ A+S EI ++T + + +Q + YL+ L Sbjct: 115 RNFLQSRGKKRKEKQIDAEEKSEKSSASSGEILKQVLTPKEDDFSAQRQFIGYLREL 171 >SB_21831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 551 Score = 29.9 bits (64), Expect = 2.0 Identities = 17/44 (38%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = +3 Query: 249 DPEFNDDYHEAEESIEPTNHEISKNTRQATLEI-YLQKIKKSNM 377 DPE+N+DY PT + KN+RQ L I ++ K KK + Sbjct: 220 DPEYNEDYD------NPTTTKTGKNSRQFCLSIFFISKDKKEEV 257 >SB_23154| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1051 Score = 29.5 bits (63), Expect = 2.6 Identities = 20/99 (20%), Positives = 40/99 (40%) Frame = +1 Query: 43 TDGTRNSSAEGSGWDSHRTTRKTLRQTFGKDFTPRKSLRALVMEKSAKRQTALVDAKEIS 222 T+ R+SS++ T T G P++ +L+ +++ + + Sbjct: 447 TENNRSSSSQPPPSQDQTTASTATTTTTGNPTPPQQHKNSLLPQRNHSIALLVTIPRHTM 506 Query: 223 KMPQANSTEIPNLMMTTMKQRNQSNQQIMKYLKILVKQP 339 K P + + + TMKQ N S ++ + +KQP Sbjct: 507 KQPNHSIALLVTIPRHTMKQPNHSIALLVTIPRHTMKQP 545 >SB_23772| Best HMM Match : Remorin_C (HMM E-Value=1.9) Length = 158 Score = 29.5 bits (63), Expect = 2.6 Identities = 18/63 (28%), Positives = 34/63 (53%), Gaps = 5/63 (7%) Frame = +3 Query: 249 DPEFN---DDYHEAEESIEPTNHEISKNTRQATLEIY-LQKIKKSNMEKN-MRIEQEVRN 413 D E+N DDY +++ E + +++ + +Q + Y QKI + + +R EQEV Sbjct: 33 DNEYNKNVDDYSNGDDNYERSTSQVTIDAQQRVVAKYRRQKIAREREQNTYLRAEQEVEK 92 Query: 414 SLK 422 +L+ Sbjct: 93 ALQ 95 >SB_52694| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1450 Score = 29.1 bits (62), Expect = 3.4 Identities = 14/71 (19%), Positives = 39/71 (54%) Frame = +3 Query: 249 DPEFNDDYHEAEESIEPTNHEISKNTRQATLEIYLQKIKKSNMEKNMRIEQEVRNSLKAM 428 D E N+D EE ++ T H I+ + + E +++ ++ +++++QEV+ +++ + Sbjct: 443 DEEKNEDVELVEEDVDDTAHNITADEGEEKEE--EERVISVSLADDLQLDQEVQPAIQPL 500 Query: 429 KQCKQNVNIFK 461 Q + ++ + Sbjct: 501 CQNDRGTDLIE 511 >SB_41567| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 173 Score = 29.1 bits (62), Expect = 3.4 Identities = 13/71 (18%), Positives = 38/71 (53%) Frame = +3 Query: 249 DPEFNDDYHEAEESIEPTNHEISKNTRQATLEIYLQKIKKSNMEKNMRIEQEVRNSLKAM 428 D E N+D EE ++ H I+ + + E +++ ++ +++++QEV+ +++ + Sbjct: 4 DEEKNEDVELFEEGVDDRAHNITADEGEEEEEEEEERVISVSLADDLQLDQEVQPAIQPL 63 Query: 429 KQCKQNVNIFK 461 Q + ++ + Sbjct: 64 CQNDRGTDLIE 74 >SB_19215| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1096 Score = 29.1 bits (62), Expect = 3.4 Identities = 21/71 (29%), Positives = 32/71 (45%), Gaps = 1/71 (1%) Frame = +1 Query: 19 PPVESTSMTDGTRNSSAEGSGWDSHR-TTRKTLRQTFGKDFTPRKSLRALVMEKSAKRQT 195 P +++ GT N SAE + + HR TT + G +T R+ L A A +Q Sbjct: 715 PQGSTSAQPTGTANGSAEAADDEHHRKTTHEPALSLIGL-YTRRRELAAAFTRTPAVKQR 773 Query: 196 ALVDAKEISKM 228 A + SK+ Sbjct: 774 AAEGTDDRSKI 784 >SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2248 Score = 29.1 bits (62), Expect = 3.4 Identities = 15/50 (30%), Positives = 27/50 (54%) Frame = +3 Query: 246 RDPEFNDDYHEAEESIEPTNHEISKNTRQATLEIYLQKIKKSNMEKNMRI 395 RDP N D +E P+ H + KN+ + L+K K+N++ N+++ Sbjct: 775 RDPSANSDGRGTDE---PSGH-LDKNSNSEVSDETLEKTLKANVQDNIKV 820 >SB_33233| Best HMM Match : Vicilin_N (HMM E-Value=1) Length = 305 Score = 29.1 bits (62), Expect = 3.4 Identities = 13/71 (18%), Positives = 38/71 (53%) Frame = +3 Query: 249 DPEFNDDYHEAEESIEPTNHEISKNTRQATLEIYLQKIKKSNMEKNMRIEQEVRNSLKAM 428 D E N+D EE ++ H I+ + + E +++ ++ +++++QEV+ +++ + Sbjct: 189 DEEKNEDVELFEEGVDDRAHNITADEGEEEEEEEEERVISVSLADDLQLDQEVQPAIQPL 248 Query: 429 KQCKQNVNIFK 461 Q + ++ + Sbjct: 249 CQNDRGTDLIE 259 >SB_3122| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1246 Score = 29.1 bits (62), Expect = 3.4 Identities = 22/64 (34%), Positives = 32/64 (50%), Gaps = 1/64 (1%) Frame = +3 Query: 258 FNDDYHEAEESIEPTNHEISKNTRQATLEIYLQKIKKSNMEKNMRIEQEVRN-SLKAMKQ 434 FN+ Y E + + +P N +N EI + I K ++E+ R Q RN SL A + Sbjct: 511 FNELYQEEQANFQPGNRNDPENPDNCVDEIGFRYIIKEDIERAWR--QVARNESLNA--K 566 Query: 435 CKQN 446 CK N Sbjct: 567 CKLN 570 >SB_58470| Best HMM Match : VPS9 (HMM E-Value=0.0012) Length = 598 Score = 28.7 bits (61), Expect = 4.5 Identities = 17/61 (27%), Positives = 30/61 (49%), Gaps = 2/61 (3%) Frame = +3 Query: 276 EAEESIEPTNHEISKNTRQATLEIYLQKIKKSNMEKNMRIEQ--EVRNSLKAMKQCKQNV 449 EA++ +E ++S T LEI LQK + + N ++ + E R L ++ + V Sbjct: 3 EAQDEVESAKVQLSSGTNTGVLEICLQKARANRDSLNNKLLKVLEAREGLSDVEPPRGAV 62 Query: 450 N 452 N Sbjct: 63 N 63 >SB_38361| Best HMM Match : VPS9 (HMM E-Value=0.0012) Length = 882 Score = 28.7 bits (61), Expect = 4.5 Identities = 17/61 (27%), Positives = 30/61 (49%), Gaps = 2/61 (3%) Frame = +3 Query: 276 EAEESIEPTNHEISKNTRQATLEIYLQKIKKSNMEKNMRIEQ--EVRNSLKAMKQCKQNV 449 EA++ +E ++S T LEI LQK + + N ++ + E R L ++ + V Sbjct: 287 EAQDEVESAKVQLSSGTNTGVLEICLQKARANRDSLNNKLLKVLEAREGLSDVEPPRGAV 346 Query: 450 N 452 N Sbjct: 347 N 347 >SB_40415| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1512 Score = 28.7 bits (61), Expect = 4.5 Identities = 15/71 (21%), Positives = 35/71 (49%) Frame = +1 Query: 19 PPVESTSMTDGTRNSSAEGSGWDSHRTTRKTLRQTFGKDFTPRKSLRALVMEKSAKRQTA 198 P + D S ++ ++SHR T + + +++PR+S R + +++ +R + Sbjct: 1077 PVISRKPRPDTLMRSKSDFERFESHRVTEDSRTSSPDAEYSPRESPRESLQQRTPRRSHS 1136 Query: 199 LVDAKEISKMP 231 E+S++P Sbjct: 1137 -----EVSRLP 1142 >SB_37356| Best HMM Match : Integrin_alpha (HMM E-Value=0.24) Length = 118 Score = 27.9 bits (59), Expect = 7.9 Identities = 16/45 (35%), Positives = 24/45 (53%), Gaps = 2/45 (4%) Frame = +3 Query: 249 DPEFNDDYHEAEESIEPTNHEISKNTRQATLEI--YLQKIKKSNM 377 DPE+N+DY PT + KN+R+ L I ++ K KK + Sbjct: 19 DPEYNEDYE------NPTTTKTGKNSRRFCLSIFFFISKDKKEEV 57 >SB_9234| Best HMM Match : Topoisom_I_N (HMM E-Value=0) Length = 335 Score = 27.9 bits (59), Expect = 7.9 Identities = 28/87 (32%), Positives = 35/87 (40%) Frame = +3 Query: 261 NDDYHEAEESIEPTNHEISKNTRQATLEIYLQKIKKSNMEKNMRIEQEVRNSLKAMKQCK 440 N D+ E + E N E T++ LEI KK N E I E + M K Sbjct: 145 NCDFKEMHKYFEMKNEERKNMTKEEKLEI-----KKKNEE----ILNEYGFCM--MDHHK 193 Query: 441 QNVNIFKVPAKPLFARHSTKPVQTKIK 521 Q V FK+ LF P Q K+K Sbjct: 194 QRVGNFKIEPPGLFRGRGDHPKQGKLK 220 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,405,440 Number of Sequences: 59808 Number of extensions: 380055 Number of successful extensions: 1325 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 1269 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1322 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1729817375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -