BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0916 (299 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock prote... 23 0.53 DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 21 3.8 AY453651-1|AAR89057.1| 199|Tribolium castaneum serrate protein. 19 8.7 AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory recept... 19 8.7 >AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock protein 70 protein. Length = 195 Score = 23.4 bits (48), Expect = 0.53 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = +3 Query: 48 FVHLSKQKQTQDKMCDRKAVIKNADMSEEMQQD 146 F+ + KQK +D D+KA+ K E+ ++D Sbjct: 68 FIKMVKQKHKKDIRADKKALQKLRREVEKAKRD 100 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 20.6 bits (41), Expect = 3.8 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -2 Query: 277 EPKLRPTINVQVGLYFLXN 221 EP LRP + ++ L+ L N Sbjct: 107 EPNLRPKLLLKHNLFLLDN 125 >AY453651-1|AAR89057.1| 199|Tribolium castaneum serrate protein. Length = 199 Score = 19.4 bits (38), Expect = 8.7 Identities = 5/6 (83%), Positives = 6/6 (100%) Frame = -3 Query: 99 CDHTSC 82 CDHT+C Sbjct: 148 CDHTTC 153 >AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory receptor candidate 41 protein. Length = 398 Score = 19.4 bits (38), Expect = 8.7 Identities = 6/16 (37%), Positives = 12/16 (75%) Frame = +2 Query: 17 ISGYQNLNVRICSFIE 64 + +QNL+ +IC+ I+ Sbjct: 209 VKEHQNLHNKICNLID 224 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 63,395 Number of Sequences: 336 Number of extensions: 1100 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 48 effective length of database: 106,457 effective search space used: 5429307 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.3 bits)
- SilkBase 1999-2023 -