BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0916 (299 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC926.07c |dlc2||dynein light chain Dlc2|Schizosaccharomyces p... 67 6e-13 SPAC1A6.11 |||dubious|Schizosaccharomyces pombe|chr 1|||Manual 26 1.4 SPCC14G10.02 ||SPCC18B5.13|ribosome biogenesis protein Urb1|Schi... 25 2.4 SPAC17G6.04c |cpp1||protein farnesyltransferase beta subunit Cpp... 24 4.2 SPBC3H7.05c |||sequence orphan|Schizosaccharomyces pombe|chr 2||... 24 5.5 SPBC216.05 |rad3||ATR checkpoint kinase|Schizosaccharomyces pomb... 24 5.5 SPAC8E11.02c |rad24||14-3-3 protein Rad24|Schizosaccharomyces po... 23 7.3 >SPAC926.07c |dlc2||dynein light chain Dlc2|Schizosaccharomyces pombe|chr 1|||Manual Length = 85 Score = 66.9 bits (156), Expect = 6e-13 Identities = 32/66 (48%), Positives = 40/66 (60%) Frame = +3 Query: 102 AVIKNADMSEEMQQDAVDCATQALEXXXXXXXXXXXXXXXXXXXYNPTWTLIVGRNFGSY 281 AVIK DMSE+MQQ+A+ A QA+E ++PTW IVGRNFGS+ Sbjct: 2 AVIKAVDMSEKMQQEAIHAAVQAMEKFTIEKDIAAFIKREFDKKFSPTWHCIVGRNFGSF 61 Query: 282 VTHETR 299 VTHE+R Sbjct: 62 VTHESR 67 >SPAC1A6.11 |||dubious|Schizosaccharomyces pombe|chr 1|||Manual Length = 106 Score = 25.8 bits (54), Expect = 1.4 Identities = 14/39 (35%), Positives = 23/39 (58%), Gaps = 1/39 (2%) Frame = -3 Query: 174 RALELHSQQHLAASLRSCQHSL*LLCDHTSCL-GFVFAS 61 ++L L + QH+ L SC ++L +L H CL F++ S Sbjct: 39 KSLHLMTSQHIFKCLSSCNYALSIL--HNICLASFLYLS 75 >SPCC14G10.02 ||SPCC18B5.13|ribosome biogenesis protein Urb1|Schizosaccharomyces pombe|chr 3|||Manual Length = 1568 Score = 25.0 bits (52), Expect = 2.4 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = -1 Query: 176 LERLSCTVNSILLHLFAHVSILYDCF 99 LE L+ +N + +FA++ + DCF Sbjct: 565 LEFLNSCINRCISRVFAYLDVCVDCF 590 >SPAC17G6.04c |cpp1||protein farnesyltransferase beta subunit Cpp1|Schizosaccharomyces pombe|chr 1|||Manual Length = 382 Score = 24.2 bits (50), Expect = 4.2 Identities = 10/28 (35%), Positives = 14/28 (50%) Frame = -2 Query: 148 ASCCISSLMSAFFMTALRSHILSWVCFC 65 A+ C+SSL+ L L W+C C Sbjct: 161 AAVCVSSLVGISMDDPLFEGTLQWLCKC 188 >SPBC3H7.05c |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 357 Score = 23.8 bits (49), Expect = 5.5 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = -1 Query: 182 KFLERLSCTVNSILLHLFAHVSILYDC 102 KFL SC S L H FA+ SI C Sbjct: 272 KFLASCSCFFLSALFHDFAYWSISGRC 298 >SPBC216.05 |rad3||ATR checkpoint kinase|Schizosaccharomyces pombe|chr 2|||Manual Length = 2386 Score = 23.8 bits (49), Expect = 5.5 Identities = 13/41 (31%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -1 Query: 191 FN-VKFLERLSCTVNSILLHLFAHVSILYDCFAITHLVLGL 72 FN V L+R+S + + LHL + + CF++ + GL Sbjct: 258 FNFVILLKRISIGDSQLFLHLHSRIVQTLCCFSLNFIYHGL 298 >SPAC8E11.02c |rad24||14-3-3 protein Rad24|Schizosaccharomyces pombe|chr 1|||Manual Length = 270 Score = 23.4 bits (48), Expect = 7.3 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = +1 Query: 19 LRLSKS*RENLFIYRSKNKPKTRCVIAKQS 108 +RL + ++F Y N P C +AKQ+ Sbjct: 171 IRLGLALNFSVFYYEILNSPDRACYLAKQA 200 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,116,403 Number of Sequences: 5004 Number of extensions: 17177 Number of successful extensions: 47 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 46 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 46 length of database: 2,362,478 effective HSP length: 63 effective length of database: 2,047,226 effective search space used: 73700136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -