BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0916 (299 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB208107-1|BAE72139.1| 71|Apis mellifera Broad complex zinc fi... 22 1.9 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 21 3.3 AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor typ... 21 4.3 DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like recept... 20 5.7 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 20 5.7 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 20 5.7 >AB208107-1|BAE72139.1| 71|Apis mellifera Broad complex zinc finger domain-Z2 isoform protein. Length = 71 Score = 21.8 bits (44), Expect = 1.9 Identities = 6/17 (35%), Positives = 13/17 (76%) Frame = -1 Query: 173 ERLSCTVNSILLHLFAH 123 ER+ C+ NS++ H++ + Sbjct: 42 ERVYCSRNSLMTHIYTY 58 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 21.0 bits (42), Expect = 3.3 Identities = 6/14 (42%), Positives = 11/14 (78%) Frame = +3 Query: 51 VHLSKQKQTQDKMC 92 +H ++ K+T DK+C Sbjct: 1689 IHRTQVKETDDKIC 1702 Score = 19.8 bits (39), Expect = 7.6 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +2 Query: 197 HSCIHQERIXQ 229 H CI QER Q Sbjct: 1648 HDCIRQERTQQ 1658 >AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor type D2 protein. Length = 456 Score = 20.6 bits (41), Expect = 4.3 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = -3 Query: 291 RVSHTSQNYXPRSMSR*DCI 232 R HT+ NY S++ DC+ Sbjct: 74 RYLHTATNYFVTSLAFADCL 93 >DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like receptor 2 protein. Length = 581 Score = 20.2 bits (40), Expect = 5.7 Identities = 8/35 (22%), Positives = 20/35 (57%) Frame = -1 Query: 185 VKFLERLSCTVNSILLHLFAHVSILYDCFAITHLV 81 V+FL++ ++ L++ ++++Y +T LV Sbjct: 35 VEFLQQEDSSIRRDPLYIVLPITVIYAVIFVTGLV 69 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 20.2 bits (40), Expect = 5.7 Identities = 5/8 (62%), Positives = 7/8 (87%) Frame = -2 Query: 94 SHILSWVC 71 SH+L W+C Sbjct: 528 SHVLGWLC 535 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 20.2 bits (40), Expect = 5.7 Identities = 5/8 (62%), Positives = 7/8 (87%) Frame = -2 Query: 94 SHILSWVC 71 SH+L W+C Sbjct: 581 SHVLGWLC 588 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 73,233 Number of Sequences: 438 Number of extensions: 1159 Number of successful extensions: 9 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 49 effective length of database: 124,881 effective search space used: 6244050 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.3 bits)
- SilkBase 1999-2023 -