BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0915 (435 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_01_0274 - 2901033-2901778,2902475-2902634 27 5.0 03_06_0351 - 33309140-33309156,33309791-33309851,33309931-333101... 27 5.0 >10_01_0274 - 2901033-2901778,2902475-2902634 Length = 301 Score = 27.5 bits (58), Expect = 5.0 Identities = 12/38 (31%), Positives = 19/38 (50%) Frame = -1 Query: 258 PSSXARGSKLTPRXVVFSAHRGXRLQH*EXLPESAPKP 145 PSS + + + + F HR R+ H + +PE P P Sbjct: 139 PSSTSSSPECSSVAICFPCHRRHRMFHRKPMPEYQPPP 176 >03_06_0351 - 33309140-33309156,33309791-33309851,33309931-33310106, 33310191-33310248,33310581-33310685,33310793-33310850, 33310964-33311097 Length = 202 Score = 27.5 bits (58), Expect = 5.0 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = -3 Query: 403 TMLIFLLLVFALQPRCSRP 347 T++IFLLL+ AL P SRP Sbjct: 6 TLVIFLLLLLALVPALSRP 24 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,853,365 Number of Sequences: 37544 Number of extensions: 159140 Number of successful extensions: 319 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 315 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 319 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 826450812 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -