BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0898 (598 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC23G3.08c |ubp7||ubiquitin C-terminal hydrolase Ubp7|Schizosa... 25 6.3 SPAC23A1.19c ||SPAC26H5.01c|RecQ type DNA helicase Hrq1 |Schizos... 25 8.4 SPACUNK4.16c |||alpha,alpha-trehalose-phosphate synthase |Schizo... 25 8.4 >SPAC23G3.08c |ubp7||ubiquitin C-terminal hydrolase Ubp7|Schizosaccharomyces pombe|chr 1|||Manual Length = 875 Score = 25.4 bits (53), Expect = 6.3 Identities = 19/58 (32%), Positives = 29/58 (50%) Frame = -3 Query: 350 FSPS*LSSELIQYGQDRPKTFRLLYVKSCLRQETLIELLNFALIYSIWRACEQDNSIG 177 FS S LSS +I+ PKT + CL+ T +E L+ +++ C Q N +G Sbjct: 660 FSESSLSSPIIE----EPKT-----LIDCLKNFTHVEELSGENMFACENCCNQPNEVG 708 >SPAC23A1.19c ||SPAC26H5.01c|RecQ type DNA helicase Hrq1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1063 Score = 25.0 bits (52), Expect = 8.4 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +3 Query: 468 FDNFYQLFKAY*NTFYFNIYIQRAL 542 FDN + LFK NT Y +Y++ +L Sbjct: 55 FDNLFNLFKVI-NTTYTFLYLRNSL 78 >SPACUNK4.16c |||alpha,alpha-trehalose-phosphate synthase |Schizosaccharomyces pombe|chr 1|||Manual Length = 944 Score = 25.0 bits (52), Expect = 8.4 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = +1 Query: 484 NYLKLIKILFISIYISKEPYRRIWTNSYYMX*IPNPV 594 NY+K+ K +I + E IW N Y++ +P V Sbjct: 305 NYVKVNKAFADTIVDNYEQDDMIWINDYHLLLVPEMV 341 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,176,544 Number of Sequences: 5004 Number of extensions: 38694 Number of successful extensions: 98 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 93 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 98 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 260219058 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -