BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0897 (598 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g35000.1 68415.m04294 zinc finger (C3HC4-type RING finger) fa... 30 1.0 At2g42360.1 68415.m05242 zinc finger (C3HC4-type RING finger) fa... 28 4.1 At2g34990.1 68415.m04293 zinc finger (C3HC4-type RING finger) fa... 28 4.1 At3g60220.1 68416.m06730 zinc finger (C3HC4-type RING finger) fa... 28 5.4 At5g18650.1 68418.m02214 zinc finger (C3HC4-type RING finger) fa... 27 7.2 At2g26530.1 68415.m03183 expressed protein 27 7.2 At2g47410.1 68415.m05917 transducin family protein / WD-40 repea... 27 9.5 >At2g35000.1 68415.m04294 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097: Zinc finger, C3HC4 type (RING finger) Length = 378 Score = 30.3 bits (65), Expect = 1.0 Identities = 14/34 (41%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Frame = -3 Query: 329 CKVFHI-CIRVHVLHCKTCPQCRQTPLKSSQGAD 231 C VFH C+ V + TCP CR + + QG D Sbjct: 155 CHVFHADCVDVWLSEHSTCPLCRADLVLNQQGDD 188 >At2g42360.1 68415.m05242 zinc finger (C3HC4-type RING finger) family protein contains Pfam domain, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 236 Score = 28.3 bits (60), Expect = 4.1 Identities = 11/24 (45%), Positives = 15/24 (62%), Gaps = 2/24 (8%) Frame = -3 Query: 329 CK-VFHI-CIRVHVLHCKTCPQCR 264 CK +FH+ C+ + C TCP CR Sbjct: 127 CKHIFHVDCVDTWLTTCSTCPVCR 150 >At2g34990.1 68415.m04293 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097: Zinc finger, C3HC4 type (RING finger) Length = 302 Score = 28.3 bits (60), Expect = 4.1 Identities = 12/25 (48%), Positives = 14/25 (56%), Gaps = 1/25 (4%) Frame = -3 Query: 335 EACKVFHI-CIRVHVLHCKTCPQCR 264 E C VFH C+ V + TCP CR Sbjct: 114 ECCHVFHADCVSVWLSDHSTCPLCR 138 >At3g60220.1 68416.m06730 zinc finger (C3HC4-type RING finger) family protein (ATL4) contains Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger) Length = 334 Score = 27.9 bits (59), Expect = 5.4 Identities = 13/31 (41%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Frame = -3 Query: 329 CKVFHI-CIRVHVLHCKTCPQCRQTPLKSSQ 240 C FH CI + ++ +TCP CR +PL +S+ Sbjct: 137 CHAFHADCIDIWLVSNQTCPLCR-SPLFASE 166 >At5g18650.1 68418.m02214 zinc finger (C3HC4-type RING finger) family protein contains Pfam domain PF00097: Zinc finger, C3HC4 type (RING finger) Length = 267 Score = 27.5 bits (58), Expect = 7.2 Identities = 10/34 (29%), Positives = 17/34 (50%) Frame = -3 Query: 344 FHKEACKVFHICIRVHVLHCKTCPQCRQTPLKSS 243 FH + C + + R + HCK C C L+++ Sbjct: 108 FHCDDCGICRVGGRENFFHCKKCGSCYAVGLRNN 141 >At2g26530.1 68415.m03183 expressed protein Length = 317 Score = 27.5 bits (58), Expect = 7.2 Identities = 14/44 (31%), Positives = 20/44 (45%) Frame = +3 Query: 300 HSNANMKNFTSLFMKSEXXXXXXXXXXXXXNVSTHGVMTLKKKS 431 H+ ++K FTSLF K E +VS H + KK+ Sbjct: 253 HNKDSVKTFTSLFRKQEDTKNSSSRGRGSSSVSAHEFHYMSKKA 296 >At2g47410.1 68415.m05917 transducin family protein / WD-40 repeat family protein contains 5 WD-40 repeats (PF00400); similar to WDR protein, form B (GI:14970593) [Mus musculus] Length = 1589 Score = 27.1 bits (57), Expect = 9.5 Identities = 18/47 (38%), Positives = 25/47 (53%) Frame = +2 Query: 158 NDSGHHKSPSCRSDGIPTPECSSANPRLENSSEEFVDIEGKFYSEVH 298 NDS ++ S SDG CS+++ LE SSE+ D+E S H Sbjct: 841 NDSEYNAEVS--SDGARASPCSNSSNELECSSED-SDVENIHESSYH 884 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,349,603 Number of Sequences: 28952 Number of extensions: 207480 Number of successful extensions: 653 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 628 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 653 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1190791976 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -