BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0893 (448 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 ... 22 2.3 AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 ... 22 3.0 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 21 5.3 AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 20 9.3 AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 20 9.3 AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 20 9.3 >AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 491 Score = 22.2 bits (45), Expect = 2.3 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = -2 Query: 189 IRRTPSARTVESRQRSLSXYP 127 I RTP + R+R L YP Sbjct: 48 IMRTPEQMFLADRERGLKYYP 68 >AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q4 protein. Length = 491 Score = 21.8 bits (44), Expect = 3.0 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = -2 Query: 189 IRRTPSARTVESRQRSLSXYP 127 I RTP + R+R L YP Sbjct: 48 IMRTPEQLFLAERERGLKYYP 68 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 21.0 bits (42), Expect = 5.3 Identities = 9/33 (27%), Positives = 16/33 (48%) Frame = +1 Query: 64 NRIRNRGSVGVYLIPXSVSSIWVXXERPLTTFH 162 +++ G+ L+P + V RP TT+H Sbjct: 936 SKVSWEGNTERVLVPGDQTEAGVFTLRPATTYH 968 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 20.2 bits (40), Expect = 9.3 Identities = 6/15 (40%), Positives = 11/15 (73%) Frame = +2 Query: 296 PFHVIRINKMLSCAG 340 P H +R+N ++S +G Sbjct: 376 PVHPVRVNTIISFSG 390 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 20.2 bits (40), Expect = 9.3 Identities = 6/15 (40%), Positives = 11/15 (73%) Frame = +2 Query: 296 PFHVIRINKMLSCAG 340 P H +R+N ++S +G Sbjct: 376 PVHPVRVNTIISFSG 390 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 20.2 bits (40), Expect = 9.3 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = -3 Query: 182 GHQVHXQWKVVN 147 GH +H Q VVN Sbjct: 327 GHHIHAQHHVVN 338 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 97,501 Number of Sequences: 336 Number of extensions: 1834 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 10090848 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -