BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0893 (448 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY823259-1|AAX18444.1| 194|Anopheles gambiae pburs protein. 24 2.8 AJ618920-1|CAF01999.1| 204|Anopheles gambiae putative odorant-b... 22 8.6 >AY823259-1|AAX18444.1| 194|Anopheles gambiae pburs protein. Length = 194 Score = 23.8 bits (49), Expect = 2.8 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +3 Query: 144 TVDDFPLXVHLVSDEYEQL 200 T + P +HL+ +EY++L Sbjct: 84 TCETLPSEIHLIKEEYDEL 102 >AJ618920-1|CAF01999.1| 204|Anopheles gambiae putative odorant-binding protein OBPjj4 protein. Length = 204 Score = 22.2 bits (45), Expect = 8.6 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = -3 Query: 368 HASXSGAYQLQRMITFY*CG*RGKGEVSCVYGT 270 H S + + R +T C K ++CVYGT Sbjct: 129 HESINVDSEFTRYVTKPVCKADAKAFINCVYGT 161 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 443,180 Number of Sequences: 2352 Number of extensions: 7556 Number of successful extensions: 12 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 37843779 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -