BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0886 (598 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-toler... 23 2.0 AJ845189-1|CAH60166.1| 515|Tribolium castaneum putative esteras... 22 3.4 DQ138189-1|ABA03053.1| 162|Tribolium castaneum bursicon protein. 21 6.0 >EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-tolerant protein. Length = 516 Score = 23.0 bits (47), Expect = 2.0 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = -1 Query: 124 GFLLLRLPYPPIVFAIKWILR*FRHLQIEYLSMAKF 17 GFLL+ P IVF + HLQ + + + F Sbjct: 114 GFLLILTPNGKIVFVSHTVEHLLGHLQTDLMGQSIF 149 >AJ845189-1|CAH60166.1| 515|Tribolium castaneum putative esterase protein. Length = 515 Score = 22.2 bits (45), Expect = 3.4 Identities = 14/52 (26%), Positives = 24/52 (46%) Frame = +1 Query: 79 LQKQLGDMEGEVKEIQMEIAAIKRDRLDVMTKKQMNVFTPESEYLESTDSGF 234 L LG KEI ++A+ D+L +++K N++ + Y D F Sbjct: 231 LAAALGMQTTNEKEIFERLSALPVDKLLQISEKVANIWGLKKVYAPVVDGEF 282 >DQ138189-1|ABA03053.1| 162|Tribolium castaneum bursicon protein. Length = 162 Score = 21.4 bits (43), Expect = 6.0 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = +3 Query: 381 ELKLSEICHKEIPGHKEYRKYTEK 452 E +S C K PG +++ K T K Sbjct: 97 EASVSLFCPKAKPGERKFIKVTTK 120 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 130,181 Number of Sequences: 336 Number of extensions: 2571 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15039504 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -