BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0886 (598 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AM420631-1|CAM06631.1| 153|Apis mellifera bursicon subunit alph... 22 4.0 AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor typ... 22 4.0 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 22 5.3 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 21 9.2 >AM420631-1|CAM06631.1| 153|Apis mellifera bursicon subunit alpha protein precursor protein. Length = 153 Score = 22.2 bits (45), Expect = 4.0 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = +3 Query: 381 ELKLSEICHKEIPGHKEYRKYTEK 452 E +S C + PG K++RK K Sbjct: 85 EASVSLFCPRAKPGEKKFRKVITK 108 >AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor type D2 protein. Length = 456 Score = 22.2 bits (45), Expect = 4.0 Identities = 10/19 (52%), Positives = 12/19 (63%), Gaps = 3/19 (15%) Frame = -2 Query: 579 FWLCWRXF---NLYSGGCS 532 F +CW F NL+SG CS Sbjct: 344 FIICWLPFFVVNLWSGFCS 362 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 21.8 bits (44), Expect = 5.3 Identities = 13/49 (26%), Positives = 24/49 (48%) Frame = +1 Query: 382 N*NSAKYVIKKFLDIKNIGNIPKKRWRL*KRQSEN*KRNWRKQNDSERE 528 N ++ Y +KF ++N N R R + + ++ + W Q + ERE Sbjct: 4 NISNYSYHDEKFKQLRNEDNKIDLRSRTKEERLQHRREAWLIQQERERE 52 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 21.0 bits (42), Expect = 9.2 Identities = 13/49 (26%), Positives = 24/49 (48%) Frame = +1 Query: 382 N*NSAKYVIKKFLDIKNIGNIPKKRWRL*KRQSEN*KRNWRKQNDSERE 528 N +S + +KF ++N N R R + + ++ + W Q + ERE Sbjct: 4 NISSYSHHDEKFKQLRNEDNEIDLRSRTKEERLQHRREAWLIQQERERE 52 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 153,407 Number of Sequences: 438 Number of extensions: 3491 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17482179 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -