BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0880 (598 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC364.06 |nap1||nucleosome assembly protein Nap1 |Schizosaccha... 35 0.010 SPBC2D10.11c |||nucleosome assembly protein Nap2 |Schizosaccharo... 32 0.055 SPAC20G8.06 |||CCR4-Not complex subunit Not1 |Schizosaccharomyce... 26 4.8 SPAC13G6.03 |gpi7||GPI anchor biosynthesis protein Gpi7 |Schizos... 25 8.4 >SPCC364.06 |nap1||nucleosome assembly protein Nap1 |Schizosaccharomyces pombe|chr 3|||Manual Length = 393 Score = 34.7 bits (76), Expect = 0.010 Identities = 14/26 (53%), Positives = 17/26 (65%) Frame = +3 Query: 519 KGIPDFWYNIFRNVSMLSEMMQEHDE 596 KGIP+FW +NV LSEM+ DE Sbjct: 162 KGIPEFWLTAMKNVLSLSEMITPEDE 187 >SPBC2D10.11c |||nucleosome assembly protein Nap2 |Schizosaccharomyces pombe|chr 2|||Manual Length = 379 Score = 32.3 bits (70), Expect = 0.055 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +3 Query: 519 KGIPDFWYNIFRNVSMLSEMMQEHDE 596 KGIP+FW NV ++ EM+ DE Sbjct: 164 KGIPEFWLTCLHNVFLVGEMITPEDE 189 >SPAC20G8.06 |||CCR4-Not complex subunit Not1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 2100 Score = 25.8 bits (54), Expect = 4.8 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +3 Query: 126 HLLKSGVTRNEMIAAITNRLHAEAMASLP 212 HLL++ T +E AA +LH + + S P Sbjct: 1596 HLLRNSATNDETKAAFVYQLHKQGILSEP 1624 >SPAC13G6.03 |gpi7||GPI anchor biosynthesis protein Gpi7 |Schizosaccharomyces pombe|chr 1|||Manual Length = 758 Score = 25.0 bits (52), Expect = 8.4 Identities = 14/42 (33%), Positives = 25/42 (59%), Gaps = 3/42 (7%) Frame = -1 Query: 484 ILLFLTLSDGSI---LYRPS*LFFFSVITPWVETFIIIRFIC 368 ILLF ++ G++ L++P + SV T W+ + I + F+C Sbjct: 672 ILLFTSVFAGALWWCLHQPKRMMDRSVKTFWIMSSISLTFLC 713 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,171,250 Number of Sequences: 5004 Number of extensions: 39013 Number of successful extensions: 125 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 122 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 125 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 260219058 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -