BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0858 (369 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_06_0339 - 22400534-22400647,22401264-22401398,22401491-224015... 70 7e-13 08_02_1576 + 27965862-27965864,27965952-27966026,27966113-279662... 70 7e-13 11_01_0334 + 2495275-2495433,2495553-2495661,2496311-2496378,249... 56 1e-08 03_05_0586 - 25875703-25876332,25876426-25876713,25877064-258771... 31 0.28 10_01_0146 - 1719997-1720386,1721498-1721515 29 0.86 12_02_0219 + 15822050-15824896 28 2.0 06_03_1117 + 27750291-27750338,27751360-27751812,27751987-277521... 27 3.5 04_03_0916 + 20794240-20794246,20794585-20796545 27 3.5 01_06_0968 + 33466574-33466607,33467087-33467115,33467438-334675... 27 3.5 07_03_1575 - 27848977-27849095,27849254-27849302,27850270-278502... 27 4.6 03_05_0742 + 27310404-27310457,27311281-27311286,27311350-273114... 27 4.6 12_02_1263 + 27423411-27423464,27423985-27424104,27424200-274242... 27 6.1 04_04_1699 + 35462160-35462555,35463114-35463196,35463317-354633... 27 6.1 02_03_0349 + 18010414-18014283 27 6.1 11_06_0621 + 25587476-25587604,25588230-25588423,25588800-255888... 26 8.1 10_08_1023 - 22341815-22342042,22342179-22342247,22342717-223428... 26 8.1 08_02_1171 + 24880363-24881355,24882553-24882702,24883505-248842... 26 8.1 05_01_0049 - 337132-337488,337613-337765,337924-338551,338617-33... 26 8.1 04_04_0176 - 23329589-23331043 26 8.1 02_05_0114 + 25958834-25961296 26 8.1 02_01_0041 + 279583-281622,281724-282047,282315-282443,282526-28... 26 8.1 >09_06_0339 - 22400534-22400647,22401264-22401398,22401491-22401565, 22401646-22401648 Length = 108 Score = 69.7 bits (163), Expect = 7e-13 Identities = 31/48 (64%), Positives = 41/48 (85%) Frame = +3 Query: 117 LNNQVLFDKPTYEKLYKEVPQYKLITPAVVSERLKVRGSLARRALINL 260 +NN VLFD+ TY+KL EVP+YK ITP+V+SERL++ GSLARRA+ +L Sbjct: 37 VNNSVLFDQATYDKLLSEVPKYKQITPSVLSERLRINGSLARRAMKDL 84 Score = 29.1 bits (62), Expect = 1.1 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +2 Query: 242 KSTHQLREKGLIKQVVQHHGQVIYTRAT 325 ++ L ++GLI+ V H Q IYTRAT Sbjct: 79 RAMKDLMDRGLIRMVSVHCSQQIYTRAT 106 >08_02_1576 + 27965862-27965864,27965952-27966026,27966113-27966247, 27967080-27967193 Length = 108 Score = 69.7 bits (163), Expect = 7e-13 Identities = 31/48 (64%), Positives = 41/48 (85%) Frame = +3 Query: 117 LNNQVLFDKPTYEKLYKEVPQYKLITPAVVSERLKVRGSLARRALINL 260 +NN VLFD+ TY+KL EVP+YK ITP+V+SERL++ GSLARRA+ +L Sbjct: 37 VNNSVLFDQATYDKLLSEVPKYKQITPSVLSERLRINGSLARRAINDL 84 Score = 29.5 bits (63), Expect = 0.86 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +2 Query: 242 KSTHQLREKGLIKQVVQHHGQVIYTRAT 325 ++ + L +GLI+ V H Q IYTRAT Sbjct: 79 RAINDLMTRGLIRMVSVHSSQQIYTRAT 106 >11_01_0334 + 2495275-2495433,2495553-2495661,2496311-2496378, 2496476-2496577,2496853-2497003,2497173-2497222, 2497432-2497557,2497761-2497863,2498104-2498204, 2498540-2498677,2498768-2498911,2499028-2499103, 2499224-2499309,2499432-2499560,2500572-2500674, 2500776-2500843,2500912-2501013,2501432-2501527, 2501723-2501848,2502152-2502254,2502427-2502569, 2503017-2503154,2503248-2503391,2503535-2503610, 2503883-2503968,2504135-2504212,2505180-2505254, 2505362-2505496,2506240-2506272,2507886-2507905, 2508570-2508666,2508899-2509000,2510612-2510725 Length = 1126 Score = 55.6 bits (128), Expect = 1e-08 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = +3 Query: 117 LNNQVLFDKPTYEKLYKEVPQYKLITPAVVSERLK 221 +NN VLFDK TY+KL EVP+YK ITP+V+SERL+ Sbjct: 971 VNNSVLFDKATYDKLLSEVPKYKQITPSVLSERLR 1005 Score = 27.5 bits (58), Expect = 3.5 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +2 Query: 257 LREKGLIKQVVQHHGQVIYTRAT 325 L +G I+ V H Q+IYTRAT Sbjct: 1102 LESRGAIRVVSVHSSQLIYTRAT 1124 >03_05_0586 - 25875703-25876332,25876426-25876713,25877064-25877194, 25877299-25877812 Length = 520 Score = 31.1 bits (67), Expect = 0.28 Identities = 14/42 (33%), Positives = 23/42 (54%) Frame = +2 Query: 8 REGFGQTASKNTEEEGRIRWRQSQEEEVVQRKSS*QVEQPGV 133 R G G + + E G+ +WR+ +EEE Q+K + E+ V Sbjct: 345 RGGRGGESEERRRERGKGKWREEEEEEEEQQKGQEEEEEEQV 386 >10_01_0146 - 1719997-1720386,1721498-1721515 Length = 135 Score = 29.5 bits (63), Expect = 0.86 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = +1 Query: 4 RTRRLRPNSLKKHRRRRKDPVAAKPRRRS 90 R ++P+ + RRRR +P +PRRR+ Sbjct: 77 RAAEMQPDDGGQRRRRRSEPATTQPRRRA 105 >12_02_0219 + 15822050-15824896 Length = 948 Score = 28.3 bits (60), Expect = 2.0 Identities = 24/66 (36%), Positives = 33/66 (50%), Gaps = 5/66 (7%) Frame = -3 Query: 334 IALGRTRVDHLPMVLDYL---FD-ETFFPKLMSALLAREPRTFNLSDTTA-GVISLYCGT 170 + L T D + + YL FD E KL+ L +EP T N+ DTT +I +Y G+ Sbjct: 196 LPLNATVHDRIQSSIGYLGGVFDIEGHVDKLLEKLAGKEPMTVNIYDTTGESMIRMY-GS 254 Query: 169 SLYSFS 152 S S S Sbjct: 255 SNESAS 260 >06_03_1117 + 27750291-27750338,27751360-27751812,27751987-27752161, 27752227-27752551,27752705-27752786,27752820-27752889, 27753341-27753420,27753514-27753750 Length = 489 Score = 27.5 bits (58), Expect = 3.5 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = +2 Query: 14 GFGQTASKNTEEEGRIRWRQSQEEEVVQRKSS*QVEQPG 130 GFG S N+ +RWR + +++ Q Q ++PG Sbjct: 427 GFGIAISANSMLVEYLRWRSRRNQQLAQTVDDGQRQEPG 465 >04_03_0916 + 20794240-20794246,20794585-20796545 Length = 655 Score = 27.5 bits (58), Expect = 3.5 Identities = 16/51 (31%), Positives = 24/51 (47%), Gaps = 1/51 (1%) Frame = -1 Query: 207 IRQQV*LACTVGLPCTVSH-MWVYQTTPGCSTCHELFLWTTSSSWLCRHRI 58 I Q + L +G C + VY+ P S H+LF T+ +W R+ I Sbjct: 399 IIQHINLVKLIGFCCEGGRRLLVYEHMPNRSLDHQLFQTNTTLTWNIRYEI 449 >01_06_0968 + 33466574-33466607,33467087-33467115,33467438-33467595, 33468319-33468436,33468520-33468708,33469008-33469343, 33469468-33469569,33469696-33469890,33469993-33470155, 33470314-33470579,33470670-33470765,33470860-33471255, 33471403-33471501 Length = 726 Score = 27.5 bits (58), Expect = 3.5 Identities = 16/42 (38%), Positives = 23/42 (54%), Gaps = 4/42 (9%) Frame = -3 Query: 295 VLDYLFD----ETFFPKLMSALLAREPRTFNLSDTTAGVISL 182 V+D+L D TFFP+++S + T+ SD GVI L Sbjct: 281 VVDFLMDPYNYRTFFPEVISGAVTNRIYTWPTSDGYNGVIQL 322 >07_03_1575 - 27848977-27849095,27849254-27849302,27850270-27850287, 27850798-27851786,27852119-27852733,27852893-27852921, 27853990-27854453,27854530-27854654,27854743-27855025, 27855112-27856102,27856965-27857576,27857666-27858630 Length = 1752 Score = 27.1 bits (57), Expect = 4.6 Identities = 23/85 (27%), Positives = 38/85 (44%), Gaps = 2/85 (2%) Frame = -3 Query: 361 LYHSLCDWIIALGRTRVDHLPMVLDY--LFDETFFPKLMSALLAREPRTFNLSDTTAGVI 188 LY C +I+ + T D L Y +FD L + L P ++++ +I Sbjct: 516 LYFGTCGYILVVESTAEDSLDSTCHYYGIFDHH---SLFNVLRTCHPSYSSITN----MI 568 Query: 187 SLYCGTSLYSFSYVGLSNNTWLFNL 113 SL+ GT++ SF G N F++ Sbjct: 569 SLFWGTAIDSFDSNGRCENNKEFSI 593 >03_05_0742 + 27310404-27310457,27311281-27311286,27311350-27311469, 27311597-27311695,27311787-27311795,27311843-27311980, 27312084-27312218,27312308-27312517,27312592-27312798, 27312891-27313010,27313079-27313198,27313279-27313401, 27313501-27313605,27313764-27313908,27314658-27315148, 27315236-27315268,27315556-27315637,27315747-27315907, 27316021-27316206,27316294-27316476,27316573-27316751, 27317009-27317105 Length = 1000 Score = 27.1 bits (57), Expect = 4.6 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 2/50 (4%) Frame = -3 Query: 220 FNLSDTTAGVISLYCGTSLYSFSYVGL--SNNTWLFNLSRTFPLDHFFFL 77 F ++ A +I++Y + S +G + WL+NL FPLD FL Sbjct: 843 FFVAQLIATLIAVYANWAFTSIKGIGWGWAGIVWLYNLVFYFPLDIIKFL 892 >12_02_1263 + 27423411-27423464,27423985-27424104,27424200-27424298, 27424405-27424542,27424647-27424706,27424865-27425044, 27425132-27425338,27425415-27425534,27425609-27425728, 27425819-27425941,27426074-27426178,27426379-27426523, 27426967-27427131,27427228-27427466,27427553-27427585, 27427894-27427975,27428100-27428260,27428422-27428607, 27428700-27428882,27428969-27429147,27429386-27429482 Length = 931 Score = 26.6 bits (56), Expect = 6.1 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 2/50 (4%) Frame = -3 Query: 220 FNLSDTTAGVISLYCGTSLYSFSYVGL--SNNTWLFNLSRTFPLDHFFFL 77 F ++ A +I++Y + S +G + WL+NL FPLD FL Sbjct: 774 FLVAQLIATLIAVYADWAFTSIKGIGWGWAGIVWLYNLIFYFPLDIIKFL 823 >04_04_1699 + 35462160-35462555,35463114-35463196,35463317-35463378, 35463745-35463806,35463932-35463991,35464079-35464111, 35464196-35464261,35464349-35464393 Length = 268 Score = 26.6 bits (56), Expect = 6.1 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = +1 Query: 10 RRLRPNSLKKHRRRRKDPVAAKPRRRSGP 96 R+ P KHRR R D A PR+R P Sbjct: 31 RQRPPPGPTKHRRLRHDADAQPPRKRGHP 59 >02_03_0349 + 18010414-18014283 Length = 1289 Score = 26.6 bits (56), Expect = 6.1 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +3 Query: 141 KPTYEKLYKEVPQYKLITPAVVSERL 218 KPT E+L K +PQ K++ AV E + Sbjct: 39 KPTRERLEKLLPQIKVVLDAVDMEHI 64 >11_06_0621 + 25587476-25587604,25588230-25588423,25588800-25588874, 25589434-25591852 Length = 938 Score = 26.2 bits (55), Expect = 8.1 Identities = 14/44 (31%), Positives = 22/44 (50%) Frame = -1 Query: 180 TVGLPCTVSHMWVYQTTPGCSTCHELFLWTTSSSWLCRHRILPS 49 T PC++S M V C TC+++ S +CR ++PS Sbjct: 264 TCATPCSLSFM-VDCLIKACITCYDVQATICLFSGICRLGVVPS 306 >10_08_1023 - 22341815-22342042,22342179-22342247,22342717-22342840, 22343193-22343317,22343815-22344276,22344357-22344700, 22345061-22345406,22345492-22345941,22346760-22347051, 22347171-22347515,22347611-22347834,22348072-22348563, 22348664-22349056,22349601-22349741,22349845-22350207, 22350494-22352683,22353298-22353360,22353434-22353535, 22353672-22354027,22354326-22354413,22354517-22354750, 22355508-22355975 Length = 2632 Score = 26.2 bits (55), Expect = 8.1 Identities = 10/18 (55%), Positives = 15/18 (83%) Frame = +2 Query: 248 THQLREKGLIKQVVQHHG 301 TH++R + LI+QV+QH G Sbjct: 1455 THKMRAEHLIRQVLQHLG 1472 >08_02_1171 + 24880363-24881355,24882553-24882702,24883505-24884210, 24885012-24885404,24885759-24885805,24886088-24886111 Length = 770 Score = 26.2 bits (55), Expect = 8.1 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -3 Query: 364 NLYHSLCDWIIALGRTRVDHLP 299 NL+H++ DW A +RV LP Sbjct: 347 NLFHTITDWYSAYVSSRVTDLP 368 >05_01_0049 - 337132-337488,337613-337765,337924-338551,338617-338852, 339563-339577 Length = 462 Score = 26.2 bits (55), Expect = 8.1 Identities = 16/41 (39%), Positives = 19/41 (46%), Gaps = 2/41 (4%) Frame = -1 Query: 120 STCHELFLWTTSSSWLCRHRILPSSSVFF--EAVWPKPSRP 4 STCH++ L S WL L S + F E VW P P Sbjct: 261 STCHKMQLPFKLSDWLSTVPTLTSLHLDFQDEMVWILPEEP 301 >04_04_0176 - 23329589-23331043 Length = 484 Score = 26.2 bits (55), Expect = 8.1 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = +2 Query: 5 GREGFGQTASKNTEEEGRIRWRQSQEEEVVQR 100 GR+GF + EE GR R R +EE +R Sbjct: 405 GRDGFDLSRKHGHEERGRYRPRVLEEEREHER 436 >02_05_0114 + 25958834-25961296 Length = 820 Score = 26.2 bits (55), Expect = 8.1 Identities = 14/44 (31%), Positives = 22/44 (50%) Frame = -1 Query: 180 TVGLPCTVSHMWVYQTTPGCSTCHELFLWTTSSSWLCRHRILPS 49 T PC++S M V C TC+++ S +CR ++PS Sbjct: 146 TCATPCSLSFM-VDCLIKACITCYDVQATICLFSGICRLGVVPS 188 >02_01_0041 + 279583-281622,281724-282047,282315-282443,282526-282648, 282768-282923,283224-283349,283426-283560,283815-283942, 284037-284148,284233-284547,284655-284771,284871-285166, 285252-285783,287980-288082,288808-288881,288965-289062, 289340-289380,289977-290032,290170-290244,290377-290469, 290602-290850,290930-291002,291681-291766,291853-291938, 292067-292142,292280-292347,292430-292496,292570-292665, 292741-292843,293214-293309,293396-293466 Length = 2047 Score = 26.2 bits (55), Expect = 8.1 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = +3 Query: 171 VPQYKLITPAVVSERLKVRGSLARRALINLGKKVSSN 281 +P Y L A V +K+RG L + GKK+S N Sbjct: 1840 IPHYYLTVDARVDNLIKLRGELNPLQESSGGKKISIN 1876 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,746,252 Number of Sequences: 37544 Number of extensions: 225477 Number of successful extensions: 738 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 725 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 738 length of database: 14,793,348 effective HSP length: 74 effective length of database: 12,015,092 effective search space used: 576724416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -