BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0856 (548 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g38680.1 68417.m05477 cold-shock DNA-binding family protein c... 30 0.89 At4g22530.1 68417.m03251 embryo-abundant protein-related similar... 30 0.89 At1g03920.1 68414.m00377 protein kinase, putative contains prote... 29 2.7 At5g66750.1 68418.m08414 SNF2 domain-containing protein / helica... 28 4.7 At4g34170.1 68417.m04848 kelch repeat-containing F-box family pr... 28 4.7 At5g42140.1 68418.m05130 zinc finger protein, putative / regulat... 27 6.2 At5g20730.3 68418.m02464 auxin-responsive factor (ARF7) identica... 27 6.2 At5g20730.2 68418.m02463 auxin-responsive factor (ARF7) identica... 27 6.2 At5g20730.1 68418.m02462 auxin-responsive factor (ARF7) identica... 27 6.2 At5g10510.1 68418.m01217 ovule development protein, putative sim... 27 8.3 >At4g38680.1 68417.m05477 cold-shock DNA-binding family protein contains Pfam domains PF00313: 'Cold-shock' DNA-binding domain and PF00098: Zinc knuckle Length = 203 Score = 30.3 bits (65), Expect = 0.89 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = -1 Query: 542 GMLGGDGERGVRCWRCSTPRHCSRHC 465 G GG G G C++C P H +R C Sbjct: 119 GGRGGGGRGGSDCYKCGEPGHMARDC 144 >At4g22530.1 68417.m03251 embryo-abundant protein-related similar to embryo-abundant protein [Picea glauca] GI:1350531 Length = 261 Score = 30.3 bits (65), Expect = 0.89 Identities = 14/26 (53%), Positives = 16/26 (61%) Frame = +1 Query: 31 DWCSILLSL*WTRRHNTAWTAGQGGG 108 DW S L +L + RHN AW AG G G Sbjct: 22 DWYSKLAAL--SHRHNLAWDAGTGNG 45 >At1g03920.1 68414.m00377 protein kinase, putative contains protein kinase domain, Pfam:PF00069 Length = 569 Score = 28.7 bits (61), Expect = 2.7 Identities = 16/35 (45%), Positives = 20/35 (57%) Frame = +1 Query: 79 TAWTAGQGGGSFSCSSDMPKRRRLQDLHHKLRVRR 183 T AG GGGS S S+ PKR + + L H + RR Sbjct: 296 TVGNAGSGGGSESVST-TPKRSQQEQLEHWQKNRR 329 >At5g66750.1 68418.m08414 SNF2 domain-containing protein / helicase domain-containing protein similar to proliferation-associated SNF2-like protein [Homo sapiens] GI:8980660; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain Length = 764 Score = 27.9 bits (59), Expect = 4.7 Identities = 16/53 (30%), Positives = 27/53 (50%) Frame = +1 Query: 244 GHCWIHTKVXGANPPLQPREQLAVHDAMAXARQQLQATELSDAALARCIESSD 402 G H + ++ PL+ + LA+ A +L T++SDA L R ++ SD Sbjct: 674 GQGQFHQERAKSSTPLEEEDILALLKEDETAEDKLIQTDISDADLDRLLDRSD 726 >At4g34170.1 68417.m04848 kelch repeat-containing F-box family protein low similarity to SKP1 interacting partner 6 [Arabidopsis thaliana] GI:10716957; contains Pfam profiles PF01344: Kelch motif, PF00646: F-box domain Length = 293 Score = 27.9 bits (59), Expect = 4.7 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = -2 Query: 319 RGPRAALSAAGAGWPXSPWCVSSN 248 R A +SA G GWP S +CV N Sbjct: 209 RWSAADMSANGWGWPGSSYCVIEN 232 >At5g42140.1 68418.m05130 zinc finger protein, putative / regulator of chromosome condensation (RCC1) family protein similar to zinc finger protein [Arabidopsis thaliana] gi|15811367|gb|AAL08940 Length = 1073 Score = 27.5 bits (58), Expect = 6.2 Identities = 14/42 (33%), Positives = 19/42 (45%) Frame = -2 Query: 322 RRGPRAALSAAGAGWPXSPWCVSSNGPEPVDPLLARAGVGSS 197 RRGP + P SP+ S+ P V P+ G+G S Sbjct: 768 RRGPPKPAVTPSSSRPVSPFSRRSSPPRSVTPIPLNVGLGFS 809 >At5g20730.3 68418.m02464 auxin-responsive factor (ARF7) identical to auxin response factor 7 GI:4104929 from [Arabidopsis thaliana] Length = 1150 Score = 27.5 bits (58), Expect = 6.2 Identities = 15/35 (42%), Positives = 19/35 (54%) Frame = -1 Query: 119 QLNEPPPWPAVQAVLCLLVHHKDNKIEHQSQDQQQ 15 QL +PP + Q L L+H N + QSQ QQQ Sbjct: 492 QLPQPPTTLSQQQQLQQLLHSSLNHQQQQSQSQQQ 526 >At5g20730.2 68418.m02463 auxin-responsive factor (ARF7) identical to auxin response factor 7 GI:4104929 from [Arabidopsis thaliana] Length = 1164 Score = 27.5 bits (58), Expect = 6.2 Identities = 15/35 (42%), Positives = 19/35 (54%) Frame = -1 Query: 119 QLNEPPPWPAVQAVLCLLVHHKDNKIEHQSQDQQQ 15 QL +PP + Q L L+H N + QSQ QQQ Sbjct: 491 QLPQPPTTLSQQQQLQQLLHSSLNHQQQQSQSQQQ 525 >At5g20730.1 68418.m02462 auxin-responsive factor (ARF7) identical to auxin response factor 7 GI:4104929 from [Arabidopsis thaliana] Length = 1165 Score = 27.5 bits (58), Expect = 6.2 Identities = 15/35 (42%), Positives = 19/35 (54%) Frame = -1 Query: 119 QLNEPPPWPAVQAVLCLLVHHKDNKIEHQSQDQQQ 15 QL +PP + Q L L+H N + QSQ QQQ Sbjct: 492 QLPQPPTTLSQQQQLQQLLHSSLNHQQQQSQSQQQ 526 >At5g10510.1 68418.m01217 ovule development protein, putative similar to ovule development protein aintegumenta (GI:1209099) [Arabidopsis thaliana] Length = 566 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = -1 Query: 68 LVHHKDNKIEHQSQDQQQTIF 6 L HH + +HQ Q QQQ F Sbjct: 504 LYHHHQQQQQHQQQQQQQNFF 524 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,370,293 Number of Sequences: 28952 Number of extensions: 189627 Number of successful extensions: 602 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 580 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 601 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1033331880 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -