Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0848
         (419 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF283275-1|AAG15376.1|  133|Anopheles gambiae small heat shock p...    65   1e-12

>AF283275-1|AAG15376.1|  133|Anopheles gambiae small heat shock
           protein protein.
          Length = 133

 Score = 64.9 bits (151), Expect = 1e-12
 Identities = 28/53 (52%), Positives = 35/53 (66%)
 Frame = +1

Query: 256 SXIKSDKDKFXVNLXVQHFAPXEISVKTADGYIVVXGKHXGXKDQHGYISRQF 414
           S +   KDKF +NL VQ F+P EISVK  D  ++V GKH   +D HGY+SR F
Sbjct: 6   SAVNISKDKFQINLDVQQFSPEEISVKYVDNCVLVEGKHEEKQDDHGYVSRHF 58


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 326,337
Number of Sequences: 2352
Number of extensions: 4763
Number of successful extensions: 6
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 563,979
effective HSP length: 58
effective length of database: 427,563
effective search space used: 34632603
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)