BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0846 (499 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ010195-1|CAA09034.1| 687|Anopheles gambiae prophenoloxidase p... 24 3.3 AJ459961-1|CAD31060.1| 700|Anopheles gambiae prophenoloxidase 8... 23 7.6 >AJ010195-1|CAA09034.1| 687|Anopheles gambiae prophenoloxidase protein. Length = 687 Score = 23.8 bits (49), Expect = 3.3 Identities = 15/43 (34%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = -3 Query: 146 LKFVLQQXGLNXIPMGAPFTRSIP*PRL-QYATAVAVXLRPNT 21 +K L Q ++ + + + R P L QYA AVA+ RP+T Sbjct: 96 IKLFLDQPDVDTLMSVSSYARDRLNPVLYQYAMAVAIQHRPDT 138 >AJ459961-1|CAD31060.1| 700|Anopheles gambiae prophenoloxidase 8 protein. Length = 700 Score = 22.6 bits (46), Expect = 7.6 Identities = 14/45 (31%), Positives = 22/45 (48%), Gaps = 1/45 (2%) Frame = -3 Query: 152 RFLKFVLQQXGLNXIPMGAPFTRS-IP*PRLQYATAVAVXLRPNT 21 + K L Q + + A + R + P QYA +VA+ RP+T Sbjct: 109 KLTKLFLDQPNADRLVDVAAYARDRLNAPLFQYALSVALLHRPDT 153 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 410,116 Number of Sequences: 2352 Number of extensions: 5785 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 44400195 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -